We analysed more than 40 000 000 questions and answers on stackoverflow.com to bring you the top of most mentioned books (5720 in total)

How we did it:

  • We got database dump of all user-contributed content on the Stack Exchange network (can be downloaded here)
  • Extracted questions and answers made on stackoverflow
  • Found all amazon.com links and counted it
  • Created tag-based search for your convenience
  • Brought it to you

For any feedback, any questions, any notes or just for chat - feel free to follow us on social networks

Recomended tags

Top entity-framework books mentioned on stackoverflow.com

Design Patterns

Ralph Johnson, Erich Gamma, John Vlissides, Richard Helm

Capturing a wealth of experience about the design of object-oriented software, four top-notch designers present a catalog of simple and succinct solutions to commonly occurring design problems. Previously undocumented, these 23 patterns allow designers to create more flexible, elegant, and ultimately reusable designs without having to rediscover the design solutions themselves. The authors begin by describing what patterns are and how they can help you design object-oriented software. They then go on to systematically name, explain, evaluate, and catalog recurring designs in object-oriented systems. With Design Patterns as your guide, you will learn how these important patterns fit into the software development process, and how you can leverage them to solve your own design problems most efficiently. Each pattern describes the circumstances in which it is applicable, when it can be applied in view of other design constraints, and the consequences and trade-offs of using the pattern within a larger design. All patterns are compiled from real systems and are based on real-world examples. Each pattern also includes code that demonstrates how it may be implemented in object-oriented programming languages like C++ or Smalltalk. 0201633612B07092001

More on Amazon.com

Clean Code

Robert C. Martin

An extremely pragmatic method for writing better code from the start, and ultimately producing more robust applications.

More on Amazon.com

Domain-driven Design

Eric Evans

Describes ways to incorporate domain modeling into software development.

More on Amazon.com

Patterns of Enterprise Application Architecture

Martin Fowler

This volume is a handbook for enterprise system developers, guiding them through the intricacies and lessons learned in enterprise application development. It provides proven solutions to the everyday problems facing information systems developers.

More on Amazon.com

Code Complete

Steve McConnell

Features the best practices in the art and science of constructing software--topics include design, applying good techniques to construction, eliminating errors, planning, managing construction activities, and relating personal character to superior software. Original. (Intermediate)

More on Amazon.com

Test-driven Development

Kent Beck

Write clean code that works with the help of this groundbreaking software method. Example-driven teaching is the basis of Beck's step-by-step instruction that will have readers using TDD to further their projects.

More on Amazon.com

CLR Via C#

Jeffrey Richter

Your essential guide to developing applications with the common language runtime (CLR) and Micrsoft.NET Framework4.0, with examles in Microsoft Visual C # 2010.

More on Amazon.com

XUnit Test Patterns

Gerard Meszaros

Improves software return on investment by teaching the reader how to refactor test code and reduce or prevent crippling test maintenance.

More on Amazon.com

Dependency Injection in .NET

Mark Seemann

"Dependency Injection in .NET" is a comprehensive guide that introduces DI to .NET developers. It covers core concepts and patterns, and introduces important DI frameworks, such as StructureMap, Windsor, and Spring.NET.

More on Amazon.com

Joe Celko's Trees and Hierarchies in SQL for Smarties

Joe Celko

Expert advice for smarties is offered from the #1 SQL guru. Trees and hierarchies are topics that all SQL users need to know, and this is the first developer's guide that addresses these concepts that are universally difficult for programmers to master. The book is Web-enhanced with downloadable SQL code, ready to use.

More on Amazon.com

Refactoring Databases

Scott W. Ambler, Pramod J. Sadalage

Brings agile/object developers and database administrators together to develop a common language for better database design and change.

More on Amazon.com

Architecting Microsoft .NET Solutions for the Enterprise

Dino Esposito, Andrea Saltarello

Provides information on designing and building effective enterprise solutions, covering such topics as UML, the business layer, the service layer, and the data access layer.

More on Amazon.com

Pro ASP.NET MVC 2 Framework

Steven Sanderson

Author Steven Sanderson has seen the ASP.NET MVC Framework mature from the start, so his experience, combined with comprehensive coverage of all the new features, including those in the official MVC development toolkit, offers the clearest understanding of how this exciting new framework can improve your coding efficiency. With this book, you’ll gain invaluable up-to-date knowledge of security, deployment, and interoperability challenges. The ASP.NET MVC 2 Framework introduces a radical high-productivity programming model that promotes cleaner code architecture, test-driven development, and powerful extensibility, combined with all the benefits of ASP.NET 3.5. In this book, the core model-view-controller (MVC) architectural concepts are not simply explained or discussed in isolation, but are demonstrated in action. You’ll work through an extended tutorial to create a working e-commerce web application that combines ASP.NET MVC with C# language features and unit-testing best practices. By gaining this invaluable, practical experience, you’ll discover MVC’s strengths and weaknesses for yourself—and put your best-learned theory into practice. What you’ll learn Gain a solid architectural background to ASP.NET MVC 2, including MVC and REST concepts. Explore the entire ASP.NET MVC Framework and take a detailed look at the official MVC development toolkit. See how it works with test-driven development in action. Capitalize on your existing knowledge quickly and easily through translation and comparison of features in classic ASP.NET to those in ASP.NET MVC. Learn about the latest security and deployment issues, including IIS 7.0. Who this book is for This book is for web developers with a basic knowledge of ASP.NET and C# who want (or need) to start using the ASP.NET MVC 2 Framework. Table of Contents What’s the Big Idea? Your First ASP.NET MVC Application Prerequisites SportsStore: A Real Application SportsStore: Navigation and Shopping Cart SportsStore: Administration and Final Enhancements Overview of ASP.NET MVC Projects URLs and Routing Controllers and Actions Controller Extensibility Views Models and Data Entry User Interface Techniques Ajax and Client Scripting Security and Vulnerability Deployment ASP.NET Platform Features Upgrading and Combining ASP.NET Technologies

More on Amazon.com

Applying Domain-driven Design and Patterns

Jimmy Nilsson

A practical guide to applying patterns in building a customized architecture for the application you are developing.

More on Amazon.com

Programming Entity Framework

Julia Lerman

Describes how to model and interact with data in .NET using Entity Framework.

More on Amazon.com

Pro C# 2010 and the .NET 4 Platform

Andrew Troelsen

The first edition of this book was released at the 2001 Tech-Ed conference in Atlanta, Georgia. At that time, the .NET platform was still a beta product, and in many ways, so was this book. This is not to say that the early editions of this text did not have merit—after all, the book was a 2002 Jolt Award finalist and it won the 2003 Referenceware Excellence Award. However, over the years that author Andrew Troelsen spent working with the common language runtime (CLR), he gained a much deeper understanding of the .NET platform and the subtleties of the C# programming language, and he feels that this fifth edition of the book is as close to a “final release” as he’s come yet. This new edition has been comprehensively revised and rewritten to make it accurately reflect the C# 4 language specification for the .NET 4 platform. You’ll find new chapters covering the important concepts of dynamic lookups, named and optional arguments, Parallel LINQ (PLINQ), improved COM interop, and variance for generics. If you’re checking out this book for the first time, do understand that it's targeted at experienced software professionals and/or graduate students of computer science (so don't expect three chapters on iteration or decision constructs!). The mission of this text is to provide you with a rock-solid foundation in the C# programming language and the core aspects of the .NET platform (assemblies, remoting, Windows Forms, Web Forms, ADO.NET, XML web services, etc.). Once you digest the information presented in these 25 chapters, you’ll be in a perfect position to apply this knowledge to your specific programming assignments, and you’ll be well equipped to explore the .NET universe on your own terms. What you’ll learn Be the first to understand the .NET 4 platform and Visual C# 2010. Discover the ins and outs of the leading .NET technology. Learn from an award-winning author who has been teaching the .NET world since version 1.0. Find complete coverage of the WPF, WCF, and WF foundations that support the core .NET platform. Who this book is for This book is for anyone with some software development experience who is interested in the new .NET Framework 4 and the C# language. Whether you are moving to .NET for the first time or are already writing applications on .NET 2.0 or .NET 3.5, this book will provide you with a comprehensive grounding in the new technology and serve as a complete reference throughout your coding career. Table of Contents The Philosophy of NET Building C# Applications Core C# Programming Constructs, Part I Core C# Programming Constructs, Part II Defining Encapsulated Class Types Understanding Inheritance and Polymorphism Understanding Structured Exception Handling Understanding Object Lifetime Working with Interfaces Understanding Generics Delegates, Events, and Lambdas Advanced C# Language Features LINQ to Objects Configuring NET Assemblies Type Reflection, Late Binding, and Attribute-Based Prog Processes, AppDomains, and Object Contexts Understanding CIL and the Role of Dynamic Assemblies Dynamic Types and the Dynamic Language Runtime Multithreaded and Parallel Programming File I/O and Object Serialization ADO.NET Part I: The Connected Layer ADO.NET Part II: The Disconnected Layer ADO.NET Part III: The Entity Framework Introducing LINQ to XML Introducing Windows Communication Foundation Introducing Windows Workflow Foundation 40 Introducing Windows Presentation Foundation and XAML Programming with WPF Controls WPF Graphics Rendering Services WPF Resources, Animations, and Styles WPF Control Templates and UserControls Building ASP.NET Web Pages ASP.NET Web Controls, Master Pages and Theme ASP.NET State Management Techniques

More on Amazon.com

Expert C# 2008 Business Objects

Rockford Lhotka

Do you want to create .NET applications that provide high performance and scalability? Do you want to employ object–oriented programming techniques in a distributed environment? Do you want to maximize the reuse and maintainability of your code? Then this book is for you. In Rockford Lhotka's Expert C# 2008 Business Objects, you'll learn how to use advanced .NET Framework capabilities alongside object-oriented design and programming to create scalable, maintainable object–oriented applications. Better still, this book includes Component-based Scalable Logical Architecture (CSLA) .NET 3.6, a widely-used framework on which you can base your application development. By using the concepts and framework in the book, you can focus more on your business issues and less on technology. Using VS 2008 and C# 3.0, Rockford Lhotka shows you how CSLA .NET 3.6 allows great flexibility in object persistence, so business objects can use virtually any data sources available. The CSLA framework supports 1–, 2– and n–tier models through the concept of mobile objects. This provides the flexibility to optimize performance, scalability, security, and fault tolerance with no changes to code in the UI or business objects. Business objects based on CSLA.NET 3.6 automatically gain many advanced features that simplify the creation of Windows forms, web forms, WPF, WCF, WF, and web services interfaces, and LINQ.

More on Amazon.com

Programming Entity Framework

Julia Lerman, Rowan Miller

Shows how to perform set operations with the DbSet class, control change tracking, fix concurrency conflicts, and confirm changes made to data.

More on Amazon.com

Pro ASP.NET MVC 4

Adam Freeman

The ASP.NET MVC 4 Framework is the latest evolution of Microsoft’s ASP.NET web platform. It provides a high-productivity programming model that promotes cleaner code architecture, test-driven development, and powerful extensibility, combined with all the benefits of ASP.NET. ASP.NET MVC 4 contains a number of significant advances over previous versions. New mobile and desktop templates (employing adaptive rendering) are included together with support for jQuery Mobile for the first time. New display modes allow your application to select views based on the browser that's making the request while Code Generation Recipes for Visual Studio help you auto-generate project-specific code for a wide variety of situtations including NuGet support. In this fourth edition, the core model-view-controller (MVC) architectural concepts are not simply explained or discussed in isolation, but are demonstrated in action. You’ll work through an extended tutorial to create a working e-commerce web application that combines ASP.NET MVC with the latest C# language features and unit-testing best practices. By gaining this invaluable, practical experience, you’ll discover MVC’s strengths and weaknesses for yourself—and put your best-learned theory into practice. The book's authors, Steve Sanderson and Adam Freeman, have both watched the growth of ASP.NET MVC since its first release. Steve is a well-known blogger on the MVC Framework and a member of the Microsoft Web Platform and Tools team. Adam started designing and building web applications 15 years ago and has been responsible for some of the world's largest and most ambitious projects. You can be sure you are in safe hands. What you’ll learn Gain a solid architectural understanding of ASP.NET MVC 4, including basic MVC Explore the entire ASP.NET MVC Framework Learn what's new in version 4 and how how best to apply these new features See how MVC and test-driven development work in action Capitalize on your existing knowledge quickly and easily through comparison of features in classic ASP.NET to those in ASP.NET MVC Learn about the latest security and deployment issues, including those related to IIS 7 Who this book is for This book is for web developers with a basic knowledge of ASP.NET and C# who want (or need) to start using the new ASP.NET MVC 4 Framework.

More on Amazon.com

LINQ in Action

Fabrice Marguerie, Steve Eichert, Jim Wooley

Provides information on using LINQ to query XML, SQL databases, ADO.NET datasets, and other data sources and offers instructions on using LINQ to improve applications.

More on Amazon.com

Programming Entity Framework

Julia Lerman, Rowan Miller

Annotation Code first is an additional means of building a model to be used with the Entity Framework and is creating a lot of excitement in the .NET development community. The reader will begin with an overview of what code first is, why it was created, how it fits into the Entity Framework and when to use it over the alternatives.

More on Amazon.com

Programming Entity Framework

Julia Lerman

Describes how to model and interact with data in .NET using Entity Framework.

More on Amazon.com

Database Management Systems

Raghu Ramakrishnan, Johannes Gehrke

Database Management Systems provides comprehensive and up-to-date coverage of the fundamentals of database systems. Coherent explanations and practical examples have made this one of the leading texts in the field. The third edition continues in this tradition, enhancing it with more practical material. The new edition has been reorganized to allow more flexibility in the way the course is taught. Now, instructors can easily choose whether they would like to teach a course which emphasizes database application development or a course that emphasizes database systems issues. New overview chapters at the beginning of parts make it possible to skip other chapters in the part if you don't want the detail. More applications and examples have been added throughout the book, including SQL and Oracle examples. The applied flavor is further enhanced by the two new database applications chapters.

More on Amazon.com

ASP.NET Web API 2: Building a REST Service from Start to Finish

Jamie Kurtz, Brian Wortman

The ASP.NET MVC Framework has always been a good platform on which to implement REST-based services, but the introduction of the ASP.NET Web API Framework raised the bar to a whole new level. Now in release version 2.1, the Web API Framework has evolved into a powerful and refreshingly usable platform. This concise book provides technical background and guidance that will enable you to best use the ASP.NET Web API 2 Framework to build world-class REST services. New content in this edition includes: • New capabilities in Web API 2 (currently version 2.1). • Support for partial updates, or PATCH. • API versioning. • Support for legacy SOAP-based operations. • How to handle non-resource APIs using REST • How to best expose relationships between resources • JSON Web Tokens, CORS, CSRF Get ready for authors Jamie Kurtz and Brian Wortman to take you from zero to REST service hero in no time at all. No prior experience with ASP.NET Web API is required; all Web API-related concepts are introduced from basic principles and developed to the point where you can use them in a production system. A good working knowledge of C# and the .NET Framework are the only prerequisites to best benefit from this book. What you’ll learn • Introduction to the REST architecture • How to design a REST API • New capabilities in ASP.NET Web API 2 • Understanding ASP.NET Web API controller activation • Automatic lifetime management for database connections and transactions • Using NHibernate with ASP.NET Web API • Easily secure a REST service, using standards-based authentication and authorization and JSON Web Tokens • Supporting legacy SOAP callers with ASP.NET Web API • How to expose relationships between resources • Supporting partial resource updates under REST • Web API versioning Who this book is for Intermediate level developers in .NET, REST, C# Table of Contents1. ASP.NET as a Service Framework 2. What is RESTful? 3. Designing Our Sample REST API 4. Building the Environment and Creating the Source Tree 5. Controllers, Dependencies, and Managing the Database Unit of Work 6. Securing the Service 7. Dealing with Relationships, Partial Updates, and Other Complexities 8. Leveraging new Web API Features to Simplify Your Code and Support Legacy Systems 9. Putting It All Together

More on Amazon.com

Professional Enterprise .NET

Jon Arking, Scott Millett

Comprehensive coverage to help experienced .NET developers create flexible, extensible enterprise application code If you're an experienced Microsoft .NET developer, you'll find in this book a road map to the latest enterprise development methodologies. It covers the tools you will use in addition to Visual Studio, including Spring.NET and nUnit, and applies to development with ASP.NET, C#, VB, Office (VBA), and database. You will find comprehensive coverage of the tools and practices that professional .NET developers need to master in order to build enterprise more flexible, testable, and extensible .NET applications with minimal upfront costs. Helps C#, VB.Net, and ASP.NET developers who wish to migrate both their applications and their own skillsets to newer, more flexible enterprise methodologies Describes each new pattern or feature along with its benefits, then outlines the pros and cons of its implementation Includes an introduction to enterprise development and a comprehensive overview of the differences between new enterprise patterns and older, traditional Microsoft programming Explains how to implement these patterns by upgrading an existing code base Covers benefits including flexibility, automated testing, extensibility, and separation; modular code; test-driven development, unit test, test automation, and refactoring; inversion of control; and object relational mapping Also covers enterprise design patterns: MVC including Ruby on Rails, Monorail, and ASP.NET MVC, MVP, observer, and more Contains a primer on object-oriented design Professional Enterprise .NET focuses on the often-inevitable compromise between forward-thinking design and the needs of business, helping you build applications that serve both.

More on Amazon.com

Entity Framework 4.0 Recipes

Larry Tenny, Zeeshan Hirani

Entity Framework 4.0 Recipes provides an exhaustive collection of ready-to-use code solutions for Entity Framework, Microsoft’s vision for the future of data access. Entity Framework is a model-centric data access platform with an ocean of new concepts and patterns for developers to learn. With this book, you will learn the core concepts of Entity Framework through a broad range of clear and concise solutions to everyday data access tasks. Armed with this experience, you will be ready to dive deep into Entity Framework, experiment with new approaches, and develop ways to solve even the most difficult data access challenges. If you are a developer who likes to learn by example, then this is the right book for you. Gives ready-to-use, real-world recipes to help you with everyday tasks Provides guideposts for learning core concepts Maps out key landmarks for experimenting with your own solutions What you’ll learn Solve the most common data access problems using Entity Framework. Implement basic data access design patterns using Entity Framework. Seamlessly model your solutions across both code and data. Improve data access performance. Use data binding to simplify and reduce your code. Leverage the recipes to empower your own exploration of Entity Framework. Who this book is for This book is for anyone learning Microsoft’s Entity Framework—Microsoft’s primary data access platform. If you have ever struggled to learn a new technology, programming model, or way of doing something, you know how helpful simple, real-world examples can be. For the beginning developer, this book provides concrete examples for common data access tasks. For developers with experience with previous Microsoft access platforms, this book provides a task-by-task mapping between previous approaches and the patterns used in Entity Framework. Table of Contents Getting Started With Entity Framework Entity Data Modeling Fundamentals Querying an Entity Data Model Using Entity Framework in ASP.NET Loading Entities and Navigation Properties Beyond the Basics with Modeling and Inheritance Working with Object Services Plain Old CLR Objects Using the Entity Framework in N-Tier Applications Stored Procedures Functions Customizing Entity Framework Objects Improving Performance Concurrency Advanced Modeling

More on Amazon.com

Entity Framework 4 in Action

Stefano Mostarda, Marcos De Sanctis, Daniele Bochicchio

Microsoft Entity Framework in Actionis an introduction to the Entity Framework for developers working in .NET who possess a working knowledge of ADO.NET. Beginning with a review of the core ideas behind the objectrelational management (ORM) model, it outlines how Entity Framework offers a smooth transition from a traditional ADO.NET approach. Featuring numerous examples and in-depth case studies, the book explores the Entity Framework story in clear, easy-to-follow detail. The infrastructure and inner workings are highlighted as needed and where they relate to particular features. This book clearly explains what Entity Framework can do for the reader, without getting sidetracked in the theoretical details of implementation. It is an ideal resource for the developer who needs to implement a solution using Microsoft technologies and has made the decision to use the Entity Framework.

More on Amazon.com

ASP.NET MVC Framework Preview

Steven Sanderson

The ASP.NET MVC framework is the latest evolution of Microsoft's ASP.NET web platform. It introduces a radical high–productivity programming model, promotes cleaner code architecture, supports test–driven development, and provides powerful extensibility, combined with all the benefits of ASP.NET 3.5. ASP.NET MVC Framework Preview is a first look at this technology's main features, designed to give you a head start getting to grips with this powerful new technology.

More on Amazon.com

Beginning ASP.NET 4

Imar Spaanjaars

This book is for anyone who wants to learn how to build rich and interactive web sites that run on the Microsoft platform. With the knowledge you gain from this book, you create a great foundation to build any type of web site, ranging from simple hobby-related web sites to sites you may be creating for commercial purposes. Anyone new to web programming should be able to follow along because no prior background in web development is assumed although it helps if you do have a basic understanding of HTML and the web in general. The book starts at the very beginning of web development by showing you how to obtain and install Visual Web Developer. The chapters that follow gradually introduce you to new technologies, building on top of the knowledge gained in the previous chapters. Do you have a strong preference for Visual Basic over C# or the other way around? Or do you think both languages are equally cool? Or maybe you haven't made up your mind yet and want to learn both languages? Either way, you'll like this book because all code examples are presented in both languages! Even if you have some experience with prior versions of ASP.NET, you may gain a lot from this book. Although many concepts from previous versions are brought forward into ASP.NET 4, you'll discover there's a lot of new stuff to be found in this book, including an introduction to the ADO.NET Entity Framework, the inclusion of jQuery, ASP.NET AJAX, the many changes to the ASP.NET 4 Framework, and much more. This book teaches you how to create a feature-rich, data-driven, and interactive web site called Planet Wrox. Although this is quite a mouthful, you'll find that with Visual Web Developer 2010, developing such a web site isn't as hard as it seems. You'll see the entire process of building a web site, from installing Visual Web Developer 2010 in Chapter 1 all the way up to putting your web application on a live server in Chapter 19. The book is divided into 19 chapters, each dealing with a specific subject. Chapter 1, “Getting Started with ASP.NET 4” shows you how to obtain and install Visual Web Developer 2010. You'll get instructions for downloading and installing the free edition of Visual Web Developer 2010, called the Express edition. You are also introduced to HTML, the language behind every web page. The chapter closes with an overview of the customization options that Visual Web Developer gives you. Chapter 2, “Building an ASP.NET Web Site” shows you how to create a new web site and how to add new elements like pages to it. Besides learning how to create a well-structured site, you also see how to use the numerous tools in Visual Web Developer to create HTML and ASP.NET pages. Chapter 3, “Designing Your Web Pages.” Visual Web Developer comes with a host of tools that allow you to create well-designed and attractive web pages. In this chapter, you see how to make good use of these tools. Additionally, you learn about CSS, the language that is used to format web pages. Chapter 4, “Working with ASP.NET Server Controls.” ASP.NET Server Controls are one of the most important concepts in ASP.NET. They allow you to create complex and feature-rich web sites with very little code. This chapter introduces you to the large number of server controls that are available, explains what they are used for, and shows you how to use them. Chapter 5, “Programming Your ASP.NET Web Pages.” Although the built-in CSS tools and the ASP.NET Server Controls can get you a long way in creating web pages, you are likely to use a programming language to enhance your pages. This chapter serves as an introduction to programming with a strong focus on programming web pages. Best of all: all the examples you see in this chapter (and the rest of the book) are in both Visual Basic and C#, so you can choose the language you like best. Chapter 6, “Creating Consistent Looking Web Sites.” ASP.NET helps you create consistent-looking pages through the use of master pages, which allow you to define the global look and feel of a page. Skins and themes help you to centralize the looks of controls and other visual elements in your site. You also see how to create a base page that helps to centralize programming code that you need on all pages in your site. Chapter 7, “Navigation.” To help your visitors find their way around your site, ASP.NET comes with a number of navigation controls. These controls are used to build the navigation structure of your site. They can be connected to your site's central site map that defines the pages in your web site. You also learn how to programmatically send users from one page to another. Chapter 8, “User Controls.” User controls are reusable page fragments that can be used in multiple web pages. As such, they are great for repeating content such as menus, banners, and so on. In this chapter, you learn how to create and use user controls and enhance them with some programmatic intelligence. Chapter 9, “Validating User Input.” A large part of interactivity in your site is defined by the input of your users. This chapter shows you how to accept, validate, and process user input using ASP.NET Server Controls. Additionally, you see how to send e-mail from your ASP.NET web application and how to read from text files. Chapter 10, “ASP.NET AJAX.” Microsoft ASP.NET AJAX allows you to create good-looking, flicker-free web pages that close the gap between traditional desktop applications and web applications. In this chapter you learn how to use the built-in Ajax features to enhance the presence of your web pages, resulting in a smoother interaction with the web site. Chapter 11, “jQuery.” jQuery is a popular, open source and cross-browser JavaScript library designed to make it easier to interact with web pages in the client’s browser. In this chapter you learn the basics of jQuery and see how to add rich visual effects and animations to your web pages. Chapter 12, “Introducing Databases.” Understanding how to use a database is critical to building web sites, as most modern web sites require the use of a database. You’ll learn the basics of SQL, the query language that allows you to access and alter data in a database. In addition, you are introduced to the database tools found in Visual Web Developer that help you create and manage your SQL Server databases. Chapter 13, “Displaying and Updating Data.” Building on the knowledge you gained in the previous chapter, this chapter shows you how to use the ASP.NET data-bound and data source controls to create a rich interface that enables your users to interact with the data in the database that these controls target. Chapter 14, “LINQ and the ADO.NET Entity Framework.” LINQ is Microsoft’s solution for accessing objects, databases, XML, and more. The ADO.NET Entity Framework (EF) is Microsoft's new technology for database access. This chapter shows you what LINQ is all about, how to use the visual EF designer built into Visual Studio, and how to write LINQ to EF queries to get data in and out of your SQL Server database. Chapter 15, “Working with Data—Advanced Topics.” While earlier chapters focused mostly on the technical foundations of working with data, this chapter looks at the same topic from a front-end perspective. You see how to change the visual appearance of your data through the use of control styles. You also see how to interact with the data-bound controls and how to speed up your application by keeping a local copy of frequently accessed data. Chapter 16, “Security in Your ASP.NET 4 Web Site.” Although presented quite late in the book, security is a first-class, important topic. This chapter shows you how to make use of the built-in ASP.NET features related to security. You learn about a number of application services that facilitate security. You also learn how to let users sign up for an account on your web site, how to distinguish between anonymous and logged-on users, and how to manage the users in your system. Chapter 17, “Personalizing Web Sites.” Building on the security features introduced in Chapter 16, this chapter shows you how to create personalized web pages with content targeted at individual users. You see how to configure and use ASP.NET Profile that enables you to store personalized data for known and anonymous visitors. Chapter 18, “Exception Handling, Debugging, and Tracing.” In order to understand, improve, and fix the code you write for your ASP.NET web pages you need good debugging tools. Visual Web Developer ships with great debugging support that enables you to diagnose the state of your application at run time, helping you find and fix problems before your users do. Chapter 19, “Deploying Your Web Site.” By the end of the book, you should have a web site that is ready to be shown to the world. But how exactly do you do that? What are the things you need to know and understand to put your web site out in the wild? This chapter gives the answers and provides you with a good look at configuring different production systems in order to run your final web site.

More on Amazon.com

Accessing Data with Microsoft .NET Framework 4

Glenn Johnson

EXAM PREP GUIDE Ace your preparation for the skills measured by MCTS Exam 70-516 - and on the job - with this official Microsoft study guide. Work at your own pace through a series of lessons and reviews that fully cover each exam objective. Then, reinforce and apply what you've learned through real-world case scenarios and practice exercises. Maximize your performance on the exam by mastering the skills and experience measured by these objectives: Modeling data Managing connections and context Querying data Manipulating data Developing and deploying reliable applications PRACTICE TESTS Assess your skills with practice tests. You can work through hundreds of questions using multiple testing modes to meet your specific learning needs. You get detailed explanations for right and wrong answers--including a customized learning path that describes how and where to focus your studies. For customers who purchase an ebook version of this title, instructions for downloading the CD files can be found in the ebook.

More on Amazon.com

javac#c++c.netalgorithmphppythonjavascriptdesignasp.netlanguage-agnosticdesign-patternsandroidoopsqllinuxdatabasematharchitectureperformanceprogramming-languagesresourcesuser-interfacemysqlhtmlsql-serverwindowsiphonerubyiosmultithreadingdata-structuresresearchobjective-csecuritycomputer-scienceassemblyruby-on-railsjquerydatabase-designdocumentationasp.net-mvcunit-testingrcompiler-constructiontestingunixcsssoftware-engineeringwpfartificial-intelligenceweb-applicationsvb.netreferenceclassvisual-studioweb-servicesoptimizationarraysnetworkingproject-managementjava-eeumleclipseosxcoding-styleagilegraphicswinformsoperating-systemmemory-managementoracleembeddedspringwinapivisual-c++image-processingmodel-view-controllerajaxhardwareparsingfunctional-programmingregexamazonmemorytddtheoryinheritancefunction3dstatisticsperlopenglkernelopen-sourcexcodeapistringnlpxmlcocoawcfentity-frameworkdebuggingmachine-learninginterfacerefactoringactionscript-3concurrencymatlabrestdomain-driven-designdelphic#-4.0stlgraphpointersnode.jsscriptingopengl-estemplatessharepointidelispsilverlightdjangoprocessparallel-processingamazon-web-servicesuntaggedcommand-linex86scalasocketssql-server-2008visual-studio-2008frameworkshtml5audioobjectlistneural-networkproject-planningvb6visual-studio-2010flexswinglinux-kernelstandardslogicproductivitysearchencryptionc++11mobilec++-faqqtscrumgccscalabilityf#genericsmfcflashhaskelltsqlsortingsoftware-designversion-controllinqsql-server-2005treeweb-scrapingterminologyimagemethodologyasynchronousvbaxamlvariablesshellasp.net-mvc-3boostexcelooadopencvusbcryptographyc#-3.0eventsphysicstypesapachepluginsnetwork-programminghibernatetcpclojurematrixsyntaxmethodsssasrecursionsignal-processinggeometrycachingfortranpostgresqlcocoa-touchdependency-injectionschemestackipadgame-enginefileclass-designauthenticationinterpreterdeploymentarduinomodelruby-on-rails-32djsondirectxbluetoothfrontendusabilityspring-mvccomputer-visionformslambdasoawebinternalscollectionslinux-device-driverfilesystemsejbexceptionnhibernatevectorqadllcomlanguage-design.net-3.5linq-to-sqlvideogarbage-collectionhttpembedded-linuxjvmsqlitenaming-conventionssystembashimplementationmvvmtimezend-frameworkwebsitebddjspdata-access-layerthread-safetyscientific-computingvalidationindexingjunitosdevmockingopensslconstructorgrailsuser-experiencexpathreal-timerelational-databasecompilationmodelingtextmongodbdata-modelingormextreme-programmingprotocolsdevelopment-environmentprojectwebformsanalysisposixlow-levelclient-serversingletonservletsdata-miningsynchronizationclrcomparisonlanguage-featuresamazon-product-apimonocommon-lispmicrocontrollercontinuous-integrationhadoopxnacomplexity-theoryasp.net-mvc-4diagramcudasimulationencapsulationrandomhyperlinkdommacrosmusicshaderprojectsgwtjoinms-accesse-commercelinked-listwindows-phone-7linkerbinarydictionarystaticanti-patternscontent-management-systempolymorphismloopsstructurevisualizationstructactionscriptjpasvndata-warehouseabstract-classgroovyclosurescss3distributedprologtfsexception-handlinganimationdynamic-programmingdiscrete-mathematicssocial-networkingiorepository-patternif-statementcpuhashautomated-testssslkeyboardcode-reviewdynamicmetaprogrammingseleniumeclipse-pluginestimationheapgenetic-algorithmcode-generationlockingclassificationolapdrupalroboticsreverse-engineeringspecificationscomputational-geometryazurenormalizationmemory-leaksdriverssisopenclprofilingopengl-es-2.0grammarraspberry-picastingjava-meelectronicsmsbuildpthreadsarmxhtmlscreen-scrapingpropertiescanvastomcatuser-interactionrenderingpython-3.xstored-proceduresinputnullandroid-ndknosql.net-4.0scopeplsqlhistorydevice-drivervhdlios5pattern-matchingmessagingrequirementscommentscpu-architectureubuntujsfcommunicationasp.net-ajaxnunitipcinversion-of-controldesign-principlesclouderlangdefinitionworkflown-tierxsltnamespacesmoduleblogssolid-principlessharepoint-2010gitgpudelegatesextjsdatasetlayoutsoaphigh-availabilityfftmakefileintegration-testingparameterscomputer-architecturenetbeansswiftruntimereporting-servicesquery-optimizationlegacygoogle-app-engineios4windows-7pocograph-theorydsltransactionsasp-classicautomationconfigurationsharepoint-2007workflow-foundationuse-caseinitializationfacebookreflectionbuttoniteratorado.netbig-odata-visualizationtimerbuildfull-text-searchactiverecordoperator-overloadingandroid-layoutcallbackjnibit-manipulationsymbianturing-machinesx86-64csvangularjsmigrationsdkconventionsexcel-vbajavafxtext-miningserializationerror-handlingbusiness-intelligenceannotationsbiztalkaopssl-certificatecucumberappleidiomaticmutexocamlcoldfusionrotationfinancebuild-processcore-dataincludedesktopfor-loopformal-verificationkinectbluetooth-lowenergyvimmapgpgpuwindbgasp.net-2.0constants.net-2.0global-variablesmultiple-inheritanceiisdownloadsrpentityreportingeditorknapsack-problemprocessordatetimemavenjbossswitch-statementcode-organizationchartsmallocbisonpkiimmutabilityloggingsoftware-qualityenumsmipsfirmwarecode-coverageserial-portseparation-of-concernscodeigniteralgebraintegrationc++-clischedulingmetricsoperatorsglassfishrspeccompressionxcode4procedural-programmingpdfcameraosgientity-framework-4.1printfcode-metricsyacclicensingfinite-automatafile-ioserviceopengl-3mdxhtml-parsingload-balancingtime-complexitycross-platformurlsignalspersistencelexwindows-8verilogunicodereadabilityportingnew-operatorwolfram-mathematicagame-physicsmapreducemulticorewhile-loopc#-2.0vm-implementationcakephprsavisual-studio-2005nestedc99colorsgdbbinary-treenamingbuild-automationcocos2d-iphonepython-2.7asp.net-mvc-2floating-pointoverloadinginternationalizationcilinformation-extractioncompiler-theorybrowserpowershellconstforeign-keysjsf-2time-managementmessage-queuehciblackberrynetwork-protocolsglslencodingsaasopengl-4uitableviewudpilgembsdmultidimensional-arraystatic-methodswebglidiomscertificateaesioc-containerrtoslocalizationadaptercurlbeautifulsoupintegermanualtask-parallel-librarystreamclient-sidelatextaskswtautomataphpunitmoqatomicejb-3.0expression-blenddnsclientawtreviewsql-server-2012terminalpseudocodelinear-algebrapass-by-referencecontact-formcqrsweb-crawlercode-smellstrategy-patternexpressstatedriverspublic-key-encryptionvisual-studio-2013prototypeevolutionary-algorithmbackbone.jsspeech-recognitiondrawingosx-snow-leoparduser-controlssemantic-webselectentity-framework-4booleanpermissionsbioinformaticspsychologyvisual-studio-2012heuristicsrdbmslucenesteganographyjsoupaugmented-realityinterruptpair-programmingcallscrapecompact-frameworkbindingtime-seriesinteropdata-accessglutraytracingdependenciesfactorydevicewarningstemporal-databaseseoreturn-valuedevelopment-processnumbersfactory-patterndistributed-computingsmltransitionjdbcjerseytext-editorlaravelbusiness-logicsessionpattern-recognitionfiltersystem-callscontrollerthreadpooloutlooksql-server-2000jitsetasp.net-web-apiwordpresscdimemcachedbytecodestate-machinesbitmapunity3dmathematical-optimizationrmibrancharraylistopenmpcomponentsconditionalsicpluagame-theorythisocrbiztalk-2010jquery-mobileevent-handlingactivexsyncarchitectural-patternsxsdsynthesispathatlnumerical64bitcode-snippetsassertbinary-search-treeinsertrazorsasjoomlanfcinternalxunitcoordinatesemacsui-designcompiler-errorssamplevirusdatamodelteamworksystems-programmingjiracontext-free-grammarawkstdschemadatehttpssolrgraphic-designandroid-activityvirtual-memoryauthorizationgrepsmart-pointersesbcopybatch-fileiterationvirtual-functionsasync-awaitninjectconditional-statementscgiprimitivefunctorrelease-managementrequestapi-designstatic-analysisassertionsphotoshopstylesorderdatabase-schemaactordiscoveryabstractionwindows-cebuffereclipse-rcpmvpbuffer-overflowantoracle11gdatabase-connection.net-3.0windows-mobileclass-diagramtraitsrssquartz-graphicscvsshopping-cartbigdatamvvm-lightfpgaroutingef-code-firstphysics-enginegdicobolprobabilitytelecommunicationsegmentation-faultsharepoint-brandingtimeoutwebsocketsemaphoredaemonjava-ee-6akkacrashhashmapmysqliobserver-patterndsl-toolscapacity-planningdesktop-applicationwindows-xpiis-7batterysql-server-2008-r2attributesmetadatacluster-analysisevent-drivencompile-timedifferential-equationssql-injectionprojects-and-solutionsexploitversioningdaohashtablegnuobject-oriented-analysisload-testinglambda-calculusidisposablerdfmongrelcollision-detectionportsymfony2consolefault-toleranceggplot2jpegc++14performancepointviewcompiler-developmentgraph-algorithmyiiregressionargumentstfs2010qt4loginwtlpublish-subscribemodularityimportmontecarlomousequeuekernel-modulesearch-enginelock-freecode-analysisreference-manualprotectedcustom-controlsinstanceguidcontrolsrepositorycompiler-optimizationrestful-architecturecsprojstrutsmonodevelopcalculatormiddlewarefuzzy-logicdojodatabase-performancerunnabledrupal-7business-logic-layercode-contractsprintingxamarin.iosxpagesnativeshared-memorysharepoint-designerautomated-refactoringmudtry-catchwcf-data-servicesequationpygamekr-cbinary-searcht4smalltalkrelationalwirelesss4race-conditionpackage-designbenchmarkingcharacter-encodingheader-filesasp.net-mvc-routingdatamapperinline-assemblydoubleheaderlanguage-theorylabviewanalyticsdata-analysisvisual-sourcesafemarkovtranslationtypedefstack-overflowcore-animationjmsdirectoryundefined-behaviorvalue-typesynchronizedlucene.netlegacy-codecpu-registersfsmmpifunctional-testingarticlelibrariesdata-bindingoracle10grecommendation-enginesencha-touchapplyuikithidden-markov-modelsgocore-bluetoothfreebsdextensibilityprimary-keymlrcpdisposeresharpersdlcforkneo4jsimple-html-domworkflow-foundation-4rich-internet-applicationcode-access-securityhalting-problembibliographyunity-containerpaginghashcodescreendcomwixp2ptokenddd-repositorieskeyboard-shortcutscordovajavascript-eventselfbug-trackingscjpwindows-servicesapp-storecore-graphicsflaskmonitoringresponsive-designffmpegqt-creatorbigintegercompositionjava-7denormalizationasmxconventionlayersiliconbpmc-preprocessorreturn-typevb6-migrationlinq-to-xmlnumerical-methodsformattingplayframeworkapplication-planningentity-attribute-valuepriority-queueironrubytestcasesymbolspredictionredminemaintenancecomputation-theoryprojectionmaintainabilityforms-authenticationdatabase-partitioningpuzzleobfuscationbehaviorms-wordwebcamred-black-treetwittercommand-line-interfacedomain-modelinformation-retrievalimage-manipulationgenetic-programmingxquerymany-to-manyui-guidelinesreleasevideo-streamingc++-standard-libraryassignment-operatorergonomicslinq-to-entitiesosx-leoparddrycontainersmockitohidden-featureslexical-analysisadvertisingviewssnmpequalsejb-3.1oltprolesjunit4kinect-sdkrhino-mocksdirectx-11identitydisassemblingwinsockcfmlequalityaccelerometern-tier-architectureglobalizationtfsbuildsemanticsprivateui-patternsorganizationaggregationgetsizeprototypal-inheritancecalendarreplacemyeclipsepermutationnantscripting-languageactive-directoryvstoruby-on-rails-4function-pointersdesign-timelazy-evaluationperformance-testingwindows-phoneconstraintsstress-testingwebviewbnfserver-sideruby-on-rails-pluginssql-server-expressgoogle-chrometagssilverlight-4.0flex4.5packetiostreamprecisiontwistedhierarchical-datainformixmobile-websitesinatrainferencewaitb-treedumpallocatorpersonal-software-processaccessibilitymixinsshared-ptrantlrspatialflex4pipescalingtriggersgethashcodeassociative-arrayenterprisesystem-designcontinuous-deliverygrizzlypaypalcmdappceleratorscrapycouplinglistboxvisual-studio-2015passwordsamazon-ec2nonblockingfreenutchfuturecruisecontrol.netsyntax-errorbayesianimage-recognitionansi-sqlsvmpreprocessorfractalsdeadlockethernetfatbytecpu-cachescipyoverflownamed-entity-recognitionutf-8cassandraparser-generatorechokindle-fireformal-languagesspectrumienumerabledomainservicesmessagedynamics-crmrulescounthigher-order-functionssubstringmasmnotationblockingunions2d-gamesvocabularyraspbianfibonacciadalexercapybaraoracle-adfagile-processeskey-bindingsnservicebustornadoentity-framework-5simdfontsinner-classeswindows-ntregular-languageimperative-programmingthree.jsvideo-game-consolessmartphonedatagridviewreportflash-cs3hashsetsseusingastronomyface-recognitiongettercastle-windsorinterrupt-handlingcode-formattingerbcritical-sectiongetter-setterldapprivate-membersmapsaggregatenumerical-analysisgradleintlow-latencymoduloxlibdirected-acyclic-graphsconnectionvoting-systemjava-2dtclbootloaderstring-matchinginterpreted-languagetkinteramazon-mwsteamsystemciderweb-apierddeliverywmikeywordxmppramgeneratordtowcf-securitypokerbindflex-lexercore-audioprototypejsfriendplatformlinguisticsframebufferexpressionnamed-pipestablestublanguage-lawyerlinear-programmingshared-librariespackageoverridedistanceexerestful-authenticationpojolocalwindows-installernavigationhbasegoogle-chrome-extensionincrementxunit.netviewstategrand-central-dispatchiocpcontinuous-deploymentchildrenhangselenium-webdrivermobile-phonesmaven-2uiviewxssdirect3dfortran90csladuplicatessumpublic-methodwindows-store-appsproofyuiredmine-pluginsvirtualizationwindowvoicesingle-sign-onsql-azureiphone-sdk-3.0phpmyadmindrupal-6asymptotic-complexitygpsnormalizingregistrycodebasehostingcrash-dumpsremotingfinalizernotificationsperforceglobalexecutablesubclassconways-game-of-liferaiidatacontextbotspostindentationtext-processingtaocpcorrelationalsahookcubessednasmreplicationdfalocalereactjsvariable-assignmentdynamic-languageshuman-computer-interfaceinformation-theoryracketversionsvideo-capturetemplate-meta-programmingfactory-methodcode-injectionhdmiasp.net-membershipoctaveplotapplescriptwifibit-shiftcom-interopmainframeetlprototype-patterncollisioncellular-automatahierarchyansiprimitive-typesbitwikiscanfstylesheetmarkov-chainsmountenumerationcode-duplicationfieldbackgroundasp.net-3.5debianequivalencemenuemgucvode.net-assemblydrupal-modulespaginationlarge-datatemplate-specializationpredicatejenacallstackloaderpreg-replacechessrewritejax-wscmakefluent-interfacereliabilitygeospatialself-hostingvirtual-address-spacethree-tierbitvectordiagrammingowlkindlemulti-tenantjoglhidwebpagesettermedia-queriesgoogle-glassgeographymedicalclassloadermultiplayermd5generic-programmingeffective-c++distributed-systemexecforeachnoiseshellcodeobd-iivalue-objectshdlpddlcrc32emailtext-analysisruby-on-rails-3.2xslt-1.0compositenvidiatail-call-optimizationsolarisgroupingparentheseswicketipv4sipclipscategory-theorymstestminimizationgsmwindows-vistafopasp.net-4.0programming-paradigmsrubygemsmanaged-directxequinoxlensdijkstrajpa-2.0memory-addressrakecoffeescriptzoomwiresharkgdcompiler-warningsaccess-specifierdependency-propertiestarget-frameworkjquery-pluginswekamemory-barriersmetalandroid-emulatorautomakeopencvdotnetdreamweavervisitoradobefirefoxinstallationtelnetdeprecatedcomposite-componentgoogle-apirestletkernighan-and-ritchieflex3wifclickliteralsclangdosnameslanguage-constructcometstylecopsimulated-annealinghandwritingmicroservicesroutessvgfacebook-fqlembedn-gramroundingforecastingtransformline-of-business-apptooltippromisemarkupdecimalgalleryredundancycompareusing-statementdocx509loadallocationreinforcement-learninggdi+fluid-dynamicspointtuplesabstract-syntax-treesysadminweb-standardsjvm-languagestic-tac-toerankingisolation-levelacidnltk6502midiuser-storiesubuntu-9.04birtdashboardfile-uploadphotosustainable-pacerelationshipjfreechartftpfailoverclusterlibcdestructordeclarationerpsqlite3nginxriad3.jsuiimageviewdesign-by-contractvbscriptcronanemic-domain-modelfinancialrailoprerequisitespartitioningxcode4.2interpolationnsstringbootstrappingjesspolymorphic-associationsprotegeenterprise-libraryprivate-methodstail-recursionetiquettewhitespacequicksortlme4powerpointsizeofdefensive-programmingsyntax-highlightinglistviewbasentfsbridgerule-engineio-completion-portslxmljythontransactionscopegui-designstandard-libraryblazedsproceduremayamacrubycomplex-numbersdhtmltextmatenp-hardalt.netstar-schemasystem.reflectioncohesionfortify-sourcepimpl-idiomxcode5java-8twitter-bootstrapcurrencymsmqtextboxntosx-mountain-lionsmlnjinventoryelispwebservernsmutablearraydynamic-memory-allocationradsimilaritybiosdialognokogiriandroid-fragmentsstoragecurve-fittingtips-and-tricksg++cubedotnetnukelalrgpu-programmingxcode4.4multi-tierinstantiationinfinite-looppackagesbookmarkslotus-dominoemulatortemplate-method-patternkohanagroup-bycookiesms-officevarflashdevelopmicro-optimizationtoolkitlinear-regressionfxcopraspberry-pi2uiviewcontrollerdctsystem.drawinglow-level-codecopy-constructorsoapuirecurrence-relationdrag-and-dropservicebussemantic-analysispalm-osgototemporalpyqturiairwindows-8.1bitwise-operatorsaffiliatemicrosoft-test-managerrelational-algebraprinciplesqtranslatepuppetsoundexterraingridworldcomboboxc89quaternionsvolatilegoogle-apps-scriptlinq-to-objectscomputation-expressiontype-inferenceonion-architecturetortoisesvnmachine-codespark-view-enginedelphi-2007spring-securityconcurrent-programmingprismwaterfallcombinationschatqmlapache-sparkidlcode-reusesystem.reactiveinnovationsigintassembliesbackendgnomejax-rsgraph-databasesoverload-resolutionsecure-codingwindows-runtimerupcodeblocksibeaconcarbontaskmanagermainpath-findingcrystal-reportsbusiness-objectscontactsxcode4.5ecmascript-5productedaunit-of-workdomain-objecteconomicsolap-cubesimulatoreaidata-storagedata-annotationslookup-tablescinboundarymodal-dialogrecursive-querynokiawhere-clauseclouderavectorizationdjango-modelsrabbitmqnumpystdinocpjppart-of-speechaccess-modifierstitanium-mobileuser-defined-functionsrecvrichtextboxjvm-hotspotscheduled-taskscrmfactorialamazon-appstoremaster-pagesautocompletevsxsetup-projectacepandasblackberry-eclipse-pluginspam-preventionbpelspeechurl-routingmingwlspimplicit-conversiongraphical-programmingbuildersdljaxbfile-get-contentssymbolic-mathprocessingdweblogicmatplotlibshapewindows-phone-8java.util.concurrentmongoidgoogle-cloud-datastoresimple-injectorintersectionaspectjvidimensional-modelingbayesian-networksmouseeventcovarianceconsole-applicationttymultiplatformpascallibusb-1.0time-estimationbotnetcomputationclustered-indexhorizontal-scalingenvironmentjbehavewindows-server-2003msbuild-taskwordpress-themingjenkinsmsdnnaturallyspeakingpdoandroid-intent.htaccessclickoncerecursive-descenttrigonometrycom+returnmalware-detectiondecouplingmandelbrotmongoosemachine-languagellvmdelphi-xemultiplicationtraversalscoringblueprint-cssbreeze-sharpp-npmath.hmasstransittegraspring-batchlaravel-4liftcamera-calibrationmicrosoft-commerce-serverconceptualalicedecompilingddddnested-classoperator-precedenceruby-1.9ssclifinalcolor-schemerenamewrapperjulia-langnew-projectdefaultinnodblongjmpgoogle-closurecython32feetabaddressbookpdeautofacspecszosprimespylonsmochaherokuiscsiyagnismartyazure-storage-queuesshallow-copystdioaddtemporarysystem.outflash-cs5kanbanscriptletbroad-phasecustom-componentsbclscala-2.10gesture-recognitionscreenshotjoomla-extensionsputtracecubic-splinewebservices-clientrailstutorial.orgeffectsautowiredwcf-configurationacceptance-testingsamsung-mobilemodularinverse-kinematicsmodule-patternselenium-rccollective-intelligencetreeviewtemplate-matchingdtdnetduinobounded-contextsirvine32gtkcustom-actionjdeveloperclr-hostingwhite-hatdirectx-9dialectweb-partsdatagramentity-relationshipxbox360nintendorecordercomputabilitygoogle-visualizationzend-framework2directcomputephp-extensiondynamic-websitesgoogle-closure-compilermergesortacsjailbreakcontroltry-with-resourcestouchscikit-learngfortranpos-taggersubquerymsbuild-4.0language-switchingcommand-line-tooljmockjfifmember-functionsreference-countingdesign-decisionslistfieldios-simulatorcore-data-migrationwindows-authenticationupdatepanelquotingurl-rewritingpowerpoint-vbasts-securitytokenserviceevent-sourcinginstructionsrequirements-managementvisioaccountinggherkinimplicitsurvival-analysissql-order-byraphaeldata-compressionat-commandskip-listsrecordingaudiounitscrummasterarduino-unoobject-recognitionmonadsdroolsthrowawaycoordinatewildcardrandom-sampleinstallshufflehttprequestprogramming-pearlsformal-methodssdatastoreaudioqueuecustom-server-controlsasn.1http-status-codesnfawgetmalwarexbeeprocedural-generationjsonpextension-methodsleft-joinzookeeperbbcodedji-sdkonclickuser-generated-contentwritingcartrestful-urlinteraction-designrelevancesignaturefactdatabase-normalizationinternet-explorersencha-touch-2jslintqmakeapache-felixlanguage-implementationtexturesdata-partitioningavrontologypsr-2avl-treeobject-detectionmultiprocessorreadonlyweb.xmlehcacherx-scaladesignerconcatenationconvention-over-configurtetrisrtfmediafragment-shaderfixed-pointreferential-integrityworldwind32bit-64bitxsl-forootkitlogarithmpartial-classesdynamics-crm-2011quartz-2dsql-server-cestatic-librariescross-browserspring-integrationsmsmodel-bindingpoeaaapache-pigassignspring-data-jpabouncycastleenvironment-variablesavrcpmixed-modeperl-moduleargcapache2sanitizationpowerbuilderspecflowstarter-kitsdivide-and-conquerpython-requestsstruts2nullablejlabelphpspecresamplingtypescriptgasfrequencymacbookproliferayflat-fileadosocket.iojavascript-frameworkcommon-table-expressionsplpure-virtualwebpage-renderingradioxml-serializationprotectionhandlermono.cecilpalm-prepv3ddelaystatelesshateoastest-firstwindows-azure-storagejarvoid-pointerscustom-exceptionsmachcakephp-1.3design-guidelineswindows-xp-embeddedtransformerdigitformulaarrange-act-assertconditional-compilationphp-internalshqlsession-stateocslabelbittorrentlazy-loadingmulti-touchamazon-dynamodbtext-justifypurely-functionalandroid-servicebignumpollingsubscriptionextendscriptjscriptrpcaxiomamigadelphi-2009metasploitphonemazecloud-hostingcredit-cardopenearsquoteswatir-webdriverpreferencesmagentogoogle-closure-librarybackpropagationjni4netusb-drivevisitor-patternshardingevaldetectnurbsjavacvargument-passingshadrillthroughxna-4.0django-viewsc11spring-datadomdocumentobject-databasescsivtabletimingexpert-systemsystem-administrationedge-detectioncharcluster-computingtestabilityfunctional-dependenciesindesigndeviseinterface-designboost-mplmatrix-multiplicationclaims-based-identityaggregate-functionsrebuildsensorweightedevent-driven-designdeep-copyminifyy-combinatorregex-lookaroundsmulebidsstatic-constructorstreamingweb-frameworksvirtual-inheritancelarge-data-volumesbarcodeip-camerajtablecocos2d-xanonymous-functionglslesappendselfmeasuresmicroprocessorsperipheralshandlestmfinite-element-analysisapp-configpushhyperthreadingci-servercontinuationslong-integermarker-interfacesmultiprocessinginstrumentspapervision3dwxpythonclonejclweb-confightml-formcode-structureunits-of-measurementclass-table-inheritanceprimefacescoutoutput-bufferingminecraftxeon-phicrtpibatispivot-tableruby-on-rails-2symfony1leaky-abstractioncode-patchingapplication-designplayframework-2.0boilerplatedunituiscrollviewcursesdigital-signaturetfs2008githubswapgetjsoncontext-switchfluxmeteortemp-tablesmixed-modelsrepresentationsquarepyjamaselggparadigmsjdk1.5autosuggestpyopenclmaster-theorembreezesetup-deploymentasp.net-web-api-routingtransposejsp-tagsinoderttidjango-1.7traveling-salesmanunique-ptrknitrsplitsettimeoutplonesshobjectcontexttestngrexxcscrx-javantdllepollxamarinstrong-typingxamppdb2bankitunesreusabilityglossarycdcjrubydisassemblyllnugetbroadcastdecompositiongoogle-analyticsunsignednexttemplate-templatesmemoizationtimelineerror-reportingtexozcircular-dependencyvotiveparallel-extensionszipargument-dependent-lookuppower-managementnmakenoexceptteamcitywssassociativityforumsphinxgridviewendiannessadka2dphtml-agility-packcyphersingly-linked-listnumericin-app-purchasetable-drivendequestatic-memberscongestion-controlshared-objectsjavadocdraggableuartcollaborationsql-updateexc-bad-accessvoipsquare-rootsocialencogbasexvirtualembedded-resourcemessageboxlapplycircuitjstlcassandra-2.0pcrevisual-c++-2008-expresscstringactivemqstatakalman-filterwsgiintentional-programmingbllportabilityeffective-javamyisampinvokesurveyclockpie-chartios6externalsimpyreductioncocoa-design-patternsstring-algorithmibm-midrangeios7code-search-enginepdb-filesmanagerempty-listvaxrss-readertypo3monitorminixprototypingesb-toolkit-2.0gae-datastorewordpress-pluginnetbeans-7mesosmulticastwshrvalue-referencesummarydisjoint-setsthread-synchronizationintellij-ideaphotographytimezonelanguage-comparisonsip-addressiokitecmascript-6fuzzingcompiler-designgradientrevisionthread-local-storageweb-traffickendo-uiapplication-serverxcode7parent-childabstract-factoryxmlhttprequestdata-integrationturing-completeredirecttrackingoperator-keywordpolicyproduction-environmentpcdatabase-projecttypingabstractcontrol-flowaslrgyroscopecbc-macmicrophonecpu-usagerandom-accesslensesdecoderemote-controlhudsonconnection-poolingmaintaining-codeflowchartscadalync-2010spring.netreference-classfull-text-indexingjnienvstack-tracejoomla2.5error-recoveryportletaudioqueueservicesternary-operatorterracottagcc-warningmeshdisambiguationgcc6soa-suitesymbol-serverpdf-generationssas-2008midlproxy-patternhuffman-codingdiagramslaw-of-demeterquantum-computingownershiptabsdimensionms-access-2007adjacency-listapache-camelwsdlgacdocument-classificationpowermockitorigid-bodiesdatacontractsettingsmvccclosconfiguration-filesauditstdmapimage-segmentationmeasurementautoboxingpicbackwards-compatibilitybase-classsignedasp.net-web-api2network-scangoogle-spreadsheetmspeccase-sensitivetechnical-debtautofixtureaxis2helperangular-momentumtext-parsingmembership-providerselectorclrsservice-brokermwstitaniumremoteiomergewpf-controlsdalvikmethod-overloadingdjango-appscorsrpgledivisionmibcode-translationconcrete-syntax-treemultilingualobject-lifetimemonoidspayloadmathematical-notationdartphpdocvoice-recognitiongawkms-media-foundationlanguage68000glibcjathastochastic-process8086findthemespoint-of-saleendpointstessellationresponse.writemultitaskingguavadocbookmsbuild-propertygroupef-model-firstflex-mobilecomputational-financeseamcombinatoricsvectormathmoneymodelscode-cleanupjava-ioaddressingdjango-querysetxorgissequencenp-completediskurllib2mutual-exclusionlibgdxmedianvisual-studio-addinssamplingsleepminimaxdatabase-theorybuilder-patternoperationcomputer-science-theoryburndownchartsopenbdzigbeezopeembeddinginstallerkshgravityelasticsearchuserandroid-canvaspaintssmswcf-bindingextendpowershell-v2.0dicomgeolocationproduct-managementconfigurehdfsvideo-processingpremature-optimizationautoloaderscheduledexecutorservicelocal-variablesiqueryablecss-floatwix3.6gnuplotgraphicgoogle-chrome-osextractcommand-line-argumentsscreen-capturecodeccopy-protectiondurationlexical-closuresjava-ee-7preg-matchfedoraiifeblueprintlegacy-databaserdfapowerpcc64thread-priorityjgraphtwampprefixinteractionfortran77failoverexecutorgpioconceptinlineobject-modelrhinohtml-tablebeagleboarddata-transfer-objectsleadmultiple-dispatchfacebook-graph-apicrudwatirdmamappingradio-buttoncode-designinterface-builderloose-couplinggreedyshadowpyobjcsmpdatabase-migrationcomputer-forensicsvoronoilibjpegserial-communication32-bitmyfacesheap-memorywcf-clientsublimetexttlbjava-streamexponentiationservicemixmahoutdecoratornullpointerexceptionphp-5.3imagemagickoutlierspivotamazon-marketplacegit-mergeadd-inevent-simulationpaxoshigh-loaddrivesflash-builderstereo-3dmanaged-c++zend-viewpearcode-readabilityeraseflyweight-patternsuffix-treebeanshellofflinejavascript-objectsagentboxingmodern-languagestest-data3d-modelexportpublicassetsmojobackground-subtractiontrafficzenossshellsorttabletuitextfieldbranch-predictionfaceted-searchopencartreportviewerstandards-complianceisabellecustom-eventsbipartitedense-rankwizardsecure-sclevent-listenerslinkifyoauth-2.0unsupervised-learninginternet-explorer-10distractionsx++smackderivativeautomappingtruncater5rsstdthreaddocumentviewerdocument-managementbluezrust-dieselmacbooknhibernate.searchlockscgpdfdocumentproducer-consumermysql-workbenchcompiler-optionsexploratorydereferencefloating-accuracychromecastmicrocodinglabelsmsys2mouseovertwo-connection-limitweb-deployment-projectend-of-lifejsscproceduralwith-statementtabbaruser-managementsentiment-analysisjquery-selectorsmembusdotnetnuke-modulepsychoacousticsaero-glasshigh-trafficbackupfact-tablexamarin.androiduninstallbcintelrectleaderstringbuilderfakeiteasyjavacardplayframework-2.5vdspobject-initializersdynamics-ax-2009rcppdbix-classsunrpcneurosciencegtdmips32rating-systemsubroutineknockout.jsxenbuttonclickinfrastructureadomd.nethypervisoractionlistenermsdeployjasminequestion2answerdbicategoryjcespacenonlinear-functions.net-attributesnanivarcolor-managementsoap-clientroinotification-bardatatablecfcmultiple-monitorsjoysticklistingsjsf-2.2recordsetvb5class-instance-variablesuser-inputbabylonjsmfccscrumboardretrospectivesclass-methodenergyfacadestdoutelementadminfont-lock-modeglsurfaceviewcalculusinteger-overflowvoidexpansionuicollectionviewlayoutportraitdenotational-semanticsqdatetimeicommandmandrilllnflowdocumentgoogle-booksquerydslmac-classictuimanagedobjectcontextsapigeneric-functiondataformrspec-railsvalueupnpvs-unit-testing-frameworkspiswigaggregaterootcommit-messagepylintdigitaliphone-privateapiflash-cs5.5angularjs-factorycyrilliclibtoolsnmpdsequence-diagramviola-jonesexecutiveshole-punchingentity-framework-corestocksimplicit-typingrosmodbusgzipipv6crypto++aliascss-selectorsddd-servicevisualsvn-serverirqgoogle-pluspage-load-timectypeswininetevent-based-programmingservice-discoveryblendinggarnet-osinfraredcontinuousxml-parsingnsarraycontrollerinventionsotpdmpmexdsaoxygenegamepadcss-frameworksbezier-curvecappuccinomemory-segmentationinit-parametersfpsgnuradioeclipse-pdtopendireulaphasebuild-errortableviewbatch-processingcode-documentationdetectionunobtrusive-javascriptandroid-layout-weightcasablancacase-classhttp-status-code-403cloud9-ideceleryconfiguration-managementinternet-explorer-6google-searchanonymousunmanaged-memoryscala-collectionsdoxygennioandroid-bleparasoftautomated-deploybacklogname-lengthcp866betamasm32clssosexexpression-treesbinary-operatorsuser-agentprinter-control-languagedistributionillegalmonitorstateexcephaxeusage-statisticssbthttpclientaddressing-modeopcparallaxrendermemory-modelosgi-bundlesql-subselectpacmancoding-efficiencyheightmotorolaair-androidregister-allocationprofilesproj4jquery-ui-pluginsminimalmodbusbusiness-rulesaudio-convertercplexdjango-templatestimtowtdiscreen-orientationlegosolr-celldmdquantifiersfipstext-to-speechseasidemp4gnuradio-companionhelpermethodsrubocoptype-librarymodelbindersoverheatingderived-classglfwsmtppitch-trackingrmarkdowntree-balancingtexture2ddevtoolsopenjdkmagic-numbersndefruby-2.2polygononmouseoverendorsedmicrosoft-metrocurly-bracesgoogle-mapsdotnet-httpclientfetchasp.net-coreteradatalcseclipse-gmflimitsocial-graphbitconverterucabsplinespring-webflowdrupal-themingsieve-of-eratosthenesz3er-diagramsjboss6.xcomparatornapebacktrackingxml-rpcwidgetsunstudiolocaldbundoruntime-errorbufferinganchorgit-commitnsimageamortized-analysisjavasoundrichtexticuadldsdynamic-loadingdefault-valuecoldfusion-9tmparameter-passingnsblockoperationadaboosttest-planenterprise-architecttstringlisthpcdevice-contexturl-validationaffinetransformnet-snmpgladestringstreampassword-hashmemory-fencesrunspaceshfbms-dosobjdumpribbonbigtablebrownfieldcontourcallbynameprepared-statementjtextfieldassembly-signingadministrationgen-eventlogical-operatorstagfilelong-doubleequivalentinterface-implementationcentercursorgoogle-earthuipopovercontrollernstimeramqpmixture-modelkeyloggerbackground-imagetesting-strategiesvirtual-machinexamarin-studioinfopath2010calayercode-first-migrationsvolatilityjavafx-8wmlreturn-value-optimizationdotnetopenauthandroid-sqlitedropwizardtrunkcore-locationreflection.emitsqlclrsql-server-2014-expressasset-pipelineflatperspectivevisual-c++-2005contractsecurity-rolessanitizeunion-findstatechartstakerberoscollaborative-filteringcrosstabbubble-sortssjscustom-error-handlingintranetsolutionakka-clusterbazelnsaffinetransformbitcountbulk-loadbusyboxtradingsingularmarshallingkeep-alivexnanimationdouble-dispatchurlopenget-requestprincipal-componentshypothesis-testnotnulldirectshowkinect-interactionstdvectorxpslisp-2atomedit-distanceprogressivedeployment-descriptorodeintansi-92nsmenuitemserializablearray-initializationmustachedatabase-integrityruntime-compilationjquery-uiundefinednon-staticgattparametric-equationslsaroundhousestripestask-trackingalarmmanagerdefaulted-functionsalgebraic-data-typesmorfikhsmraw-socketsnetfiltericefacesassimpgreasemonkeyevented-iogenuinechannelsr-gridmultiple-tablesgoogletestdataflowsize-typemultimethodcapitalizationjmockitrubymotionxor-linkedlistcompass-geolocationssairepositoryqtquick2set-covermem.-efficient-linkedlistjtagoutputradrailssiebelmanagedsdpwavefrontdlnaubuntu-14.04mapperrootgroovyshellsequencescompass-sassienumeratorfunction-overloadingyoutube-data-apiobject-role-modelingwss-3.0s#arp-architectureaforgevariadic-functionslilypondnumber-theorysonarqubeactivitiactivity-monitorasp.net-mvc-areaslyncrelational-modelfactor-langlogic-programmingpickleprims-algorithmc++-ampjspincludepaddingmemory-corruptionopenpgphfilelisdocstringxcode5.1cjksliderplaybacksize-tconceptual-modelfeedsmtajoomla3.0ext3elastic-beanstalkcodigettextmove-semanticsmobile-applicationantlr4topologyuploadnull-object-patternactiveresourcekettleshopifyflood-fillface-detectionscreen-sizearbitrary-precisionfat32remote-accessintegralamazon-fire-tvbackground-processmefshoppinglibvlcaxsfinaeparallel.foreachstate-managementhttpwebrequestdependent-namejasper-reportsandroid-runonuithreadansi-sql-92j9chaosliterate-programmingcopy-assignmentwaitpidplacementvxworksheadaveragetensorflowhardware-accelerationuiview-hierarchycapistrano8051game-loophdcpogg-theorafeature-drivenwmfcodepagesarrowsha256script#kernel-modeproject-organizationcouchdbimage-zoomfinallypalm-pre2qt5backlightedidefaultmodelbinderacr122flushoutlook-vbaapache-portable-runtimephantomjsvirtual-pathcardinalityvisiondelphi-7pbxlibavirbx509certificatecshdockpanelyuvembedded-databasemotion-detectionss7openid-providernodesfitch-proofsopen-closed-principleui-helperoracle-ucmchange-data-captureskinningrmscairngormbinary-heapplyrfreeglutlines-of-codegoogle-style-guideoverridinghttpartyfseekpostswavdynamic-reportstranslatetomcat8roxygen2forgot-passwordschedulermixerieee-754netbsdexchange-servermsbuild-targetinstancesanonymous-inner-classvideo-editingoracle8iweldlandscapeswi-prologandroid-loadermanagerin-memory-databasefoafglibthreadgroupworkflow-enginelibc++linodemercurialdouble-checked-lockingautotoolscxfmaven-javadoc-plugincustom-eventsubjecticonshaskell-platformhardware-programmingexecutorservicetype-conversiontwiliowindows-identityentitiescache-controlsaxonout-of-memoryprintersdeclarativeintrusion-detectionwcf-restsilverstripecsrfdataframemultiple-indirectionrationalestreambufdatabase-firsttao-frameworkportfoliocqlcross-domaininstallshieldreallocpre-incrementlokiubercartbessel-functionsfile-conversioncomparablestarling-frameworkcyclicbarriernscoderdigital-logicturboc++agent-based-modelingoledbphotoshop-cs4lib-nfciphone-sdk-3.2svdnswindownegationfile-descriptormediacontrollermingw64cpythondatabase-tablehlslsassblockingqueueinterlockedchange-passworddecision-treepresentation-layerphpstormwapifftjson-apirefsaltcontainsstartupcadrecursive-datastructuresphylogenyupperboundgit-gcdata-entry.net-remotingjavafx-2sound-synthesisdesign-rationalegoogle-codegoogle-play-servicesgmailhoistingstm32texnic-centerosbmatlab-cvstoracle-coherencethread-localdata-profilingexecutable-jarsimultaneousrecurring-billingnumbafortran-iso-c-bindingsgigprsas-ifproject-layoutmechanizelocal-storageuigesturerecognizerguicewebdeployfeature-detectionminesweepersyntactic-sugarmanifestproviderwebservicehost3d-reconstructionmachine-translationsoftware-estimationtilesdatabase-managementjfacetaxonomyonline-repositoryhttpcontexttable-variableconverterinvalidatelua-tablec++buildercross-compilingtype-constraintszend-studiopopularityzshautolayoutdllimporthamlwebmatrixapplepayvisual-c++-2008triangulationnuget-packagecpanelfont-sizerefreshgraph-coloringgoogle-calendararm64sourcegear-vaultgetlatestyield-returncredit-card-track-dataexchangewebserviceslrusapfrontpagegroebner-basistreemapthread-specific-storagegoalironkey-value-codingvisualvmvisual-foxprojoomla1.6ibplugingtk3fast-espbox2d-iphonemotionnsoperationlcdspec#first-class-functionsfuzz-testingflexunit4virtualhostwpfdatagridswingbuildergit-tagcpfreebaseuiimageunmanagedanonymous-methodssitecoreoutlook-addinregression-testingwardenazure-documentdbfinal-classhard-codingapache-tikadvorakcppunitintegritysharepoint-2013companion-objectmac-app-storelotussupervised-learningconcrete-inheritancegetchmmapyahoo-financevmwaresliceapache2-modulemod-sslgridrisk-analysiszend-aclhammingweightwebsphere-mqlong-pollingcucumber-jvmhapijsreference-typeinjectsimplemembershiphectorprivilegesssrs-tablixrvaluenormal-distributionjxtavector-graphicscompound-operatorumbraco-blogclasscastexceptionasp.net-mvc-5invariantsmemory-poolstatsmodelsgenerativeasyncsocketregex-greedymsbuildcommunitytasksidentifiercrackinghash-collisiondelphi-prismdataproviderterminationmultiple-columnsrestifymonomacburnobservablecollectionscikit-imagecherry-picksniffingmethod-namesandenginev8compass-luceneimage-scannercdbdigestmutableweblogic11gsysvshorthandnstreecontrollerkarma-runnerrdbms-agnosticparameter-sniffinggnupgmysql-managementfindbugsmptttexture-mappingnhibernate-mappingmysqldumpu-bootcustom-buildmailslotacronymreorganizemahjongjboss7.xabstract-methodscounterbeautifiermessage-loopqgraphicssceneyoutube-apicoordinate-systemshttphandlertemplate-enginejdoautomatondelphi-5silverlight-5.0nice-languageportsgnome-3morphiafreertosredoquadtreegalaxyqgraphicsviewknuthhp-uxmayavigreatest-n-per-groupinclude-guardsactionresultencryption-asymmetricglewaccess-tokenstagingconcreteonpaintbrowser-cachetcshappframeworkniosfscanfoverlapped-ioeclipse-emftrampolinespersistence.xmlheader-onlyusb-mass-storageuitabbarcontrollernpscsftpl-dataflowpysideolexml-attributecopy-on-writeminimum-spanning-tree2-3-4-treeunpivotcodeplexswift2splinesql-deleteminimizelifecyclesrsfasmgriffonyqlvirtualboxoctreepredictprogram-flowshippingfilestreamimage-rotationgoogle-gdkchemistryipodssrs-2008appletpython-imaging-librarysafaridiscrete-spacecoldfusion-8recordsdrop-down-menuconcattemplate-haskellcalculated-columnsbeginreadxml-validationgrantclpqsymbolcircuit-diagramlightweight-processesidiomatic-perlimpersonationobject-initializationfeature-extractionmaven-3nested-loopsvisual-studio-expressclionexplorercheckboxcross-validationtyruscommentingusing-directivestouchscreentypesafe-activatorumbracox509certificate216-bitpygtkcomposite-keyexpression-evaluationcode-behinditerableadfslarge-filesaudio-recordingtr1qgraphicstextitemuieventelliptic-curveownerdistributed-cachingnsmanagedobjectrich-domain-modelcontravariancebigdecimalbare-metalcircuit-breakersysinternalsmockupssquishgrails-2.0parsekitfwriteaccessorybrute-forcemit-scratchnetbeans-platformaudit-trailpacket-snifferslate-bindinglistenermongodb-phpmsbixllpegormdatabase-tuningruby-on-rails-3.1spring-restcontrollerkerningwaveletbinary-compatibilityalertsgnatcgpdfscannerscalar-subqueryddlcellular-networkcan-busbit.lyfile-extensionevent-loopclass-hierarchymoosepreg-match-allflagsantivirusnoncopyablemedia-playeralloyrefcountingportalmatchingconst-correctnessandroid-studioinner-joinui-threadscheduleinterceptkiffluprgbecmamfiwhite-box-testingmodemdagger-2metapostdmlgpuimagecircular-referencestack-smashtransitivityremindersopenid-connectround-robinwtsap-connectorduplexocmocksystem-verilogentropystatusbaraccess-controltablelayoutalexa-skilldelegationgalaxy-tabtostringwxwidgetspos-taggingidempotentstabilitydata-cleansingasset-managementfile-permissionsrefactoring-databasesappkitcontext-specificationintellitracerpnscaleebnfdomxpathcommitmost-vexing-parseionictodosui-testingbindingsourcehexrolapfluorinefxbreakpointsoffice-2013color-spaceposix-apiradix-sortjlistargventry-pointweb-application-projecttext-filesdifferencepayment-processingskyfieldservice-layerlaunchobject-object-mappinghuman-readablejdbctemplatetypetraitsspray-jsonmozartfisheyecashomebrewcommerceuniquexslt-2.0windows-kerneloracleformspointer-conversionputcharjquery-globalizationedirectoryfiberrustpost-incrementkissfftbin-packingdelphi-xe2cortex-auinavigationcontrollernon-exhaustive-patternsdistortionequalizerline-intersectionslugspinlockslowdownscreen-brightnessvspackageerasureweb-config-transformmaybecode-migrationnsbitmapimagerepautomatic-ref-countingclass-variablespppuniqcygwinkinect.toolboxvirtuemartsimplyvbunitre-engineeringsudokulocaltimepharoiis-expressbeagleboneblackisbnteam-buildscrollinihidden-fileshungarian-notationstripe-paymentsimpactjsgnu-toolchainusability-testingoculusnsbuttoncellwebspherepowerpivotlibsvmevent-logpath-manipulationfirebugreferential-transparencytestdrivendesignpowersetdelimiterfunction-objectfirewalldelete-filejsdocvirtualallocdrmcycleidataerrorinfoblendthriftchecksumhadoop-partitioningrootviewcontrollershift-reduce-conflicthoverdomain-service-classintellij-13callocopenjpaoffice-2007scope-identityy86unionvrlibusbapi-keymicrosoft-fakesunreal-development-kitcard.iomemory-efficientosloxnuautomapperef-database-firstimage-enhancementdfsvpsmpegbitarrayxcode4.3avx512distinctcommodoredividestorage-class-specifiertrussstreet-addressprogram-structureselinuxjqtouchspatial-queryjustmocksingle-table-inheritanceparentopamnsbuttonjquery-ui-timepickerireportgwt2session-hijackingdefaultlistmodelrowremote-serverapplication-integrationinstance-variablesandroid-widgetvisual-studio-sdkdouble-clickkendo-mobilecompiledderivedalexa-skills-kitstructured-programminghttp-errormootoolsl-systemsbasicanalysis-patternsbapiios9.3gnu-smalltalksse2spring-data-neo4j3dsodatalmdirectx-10drawrectcomparison-operatorsjxcode7.3aixamazon-storedata-generationgoutteleiningenmisusent-native-apiqtcpsocketia64autoiphone-accessorysmartcardstorewhereinsertion-sortssdtboost-date-timemagnetic-cardswebrtcandroid-frameworktfs2013business-layerintermediate-languagespring-aopc#-6.0nomenclatureentity-modellgplsharedplyrgoogle-tvtimertaskclass-attributesphotogrammetrydcidata-drivenstanford-nlph.264ocpfilechoosersurfaceerror-correctionbitspymccapturexperfviterbivelocitygprofdatamartsemicolonpublishingboost-graphmouselistenertelerikshort-circuitingfeedbackios-ui-automationbinderlatencyopenjmsnumerical-recipesraspberry-pi3eclipse-emf-ecorejfilechooserquantifydarwinrdlcdecompressionmmunested-urlseigenup-castingwebosrequest-cancellingaccelerated-c++vc6lldbhill-climbingdifferentiationpostfix-notationngroute.bash-profileappstore-approvalwebdavcode-conventionsgraphics2dgraspuitypeeditorcompatibilityconstexprdeterministicconsistencycryengineemvandroid-2.2-froyoappdatajs-test-driverresultsetektroniframeforward-declarationpostscriptsoundcardpathgeometrypowershell-remotingpy2exehtml-selectlook-and-feellanguage-conceptsxsd-validationtransducernsstreampanlower-boundiec10967scapyclojure-core.logicmelregex-negationhibernate-mappingpartial-viewsselectlistgoogle-api-clientfile-organizationscrapersingle-page-applicationaccess-vbacrc-cardsjavacctweetsfoundationinteractivelogitechstatefulrowslinearizationstringbufferistringstreamthinitextostreamqueuingledpyserialreactive-programmingretainbitflagslpcpointer-arithmeticzombie-processconcurrenthashmapcreationzend-authdynamic-language-runtimeedit-and-continuecalculated-fieldevent-dispatch-threadqprocesstopic-mapsdaggeridentity-operatorsealedeachsim900haskell-modeelementsaspects3-tierandroid-syncadapterovertonehtml5-canvaspowershell-v3.0lookupdependency-managementpublic-keygunicornopennlpmozillarabbitmqctlmechanize-rubypgpjsonpathvisual-c++-2010erase-remove-idiomsonosexplicit-conversioneloquentopendatawebbrowser-controlscientific-softwareruby-1.8suitenescgaussianquery-performancedrawstringsession-timeoutapplication-structuregetcharjlsmosstomcat6bold-delphijscript.netisp-principleobjective-c++blockpysparklinecobol85usbserialsummarizationwebdriversqlalchemynumberpadslidemodularizationpreloadinginstruction-setopenalz80custom-attributesservice-referencemsp430ninject.web.mvcpenetration-testingshell-extensionsimage-capturesynchronizealignmentmatchretina-displaycore-textexecution-timezeromqwindow-functionssecond-level-cachestatic-filesjboss-portalexternal-accessorysystem-analysiscustom-membershipproviderwidthgnu-makeopenslbackbone-routingn-layerglobalsdynamic-assembliesnetbeans-6.9uibezierpathservlet-filterstandemqvtjavafx-12phase-commitimageiconnsubstitutedata-tracingsemantic-markupmatlab-coderrails-activerecordgraphical-logoplaying-cardsdrupal-themesisolationmolesadventureworkspypylinq-to-datasetblowfishrowlockingunity5wchar-tpositioningiis-8restkitasp.net-mvc-beta1naglegoogle-oauththread-sleepweb-deploymentvalgrindios9clauseios-universal-linkswcag2.0pyephemview-model-patternlinearsystem.arraypuppet-enterprisesupervisordodp.netwcagandroid-bluetoothgraphingqtablewidgetsessionidcgaffinetransformundo-redoasp.net-core-mvcexport-to-excelrspec2iptype-aheadvgathrowabletraining-datatreapsparqlyesodvisual-studio-debugginghttp-status-code-404in-placeservicehostdjango-celerybox2dnonlinear-optimizationnprreversionjetweblogic12cinformation-visualizationmoaiwindboolongdata-collectiontomeelamppython-db-apihindley-milnergruntjsgoogle-analytics-apipodnative-codebounding-volumepolicy-based-designskinavaudioplayersubmitperformance-estimationhttppostedfilebasenmapopentksparse-matrixencodespring-elandroid-sourceproxyplovrpyqt4facebook-chatreasoningbackbone-viewslogistic-regressionselflanguagecoverflowrational-unified-processhttp-requestmouseenterword-frequencygit-cherry-pickcapprolog-topleveldoctrinefolderscbperipheraldiagnosticside-customizationfixedpagepywin32java1.4url-shorteneruiimagepickercontrollerhotswaptimespanhpricotsharepoint-apionclicklistenerunresolved-externaloculus-runtimestrictxorgmidjeemail-spaminvokelaterpentahoudevalphablendingupgradewebshopado.net-entity-data-modelsqlyogdynamic-castimmutable.jsresource-contractsproject-templatezippersystem.diagnosticsboidsvisual-studio-templatessniffercontrol-charactersegovernmentxml-signatureloadlibrarystochastictrieeasymockvariable-lengthapriorifogbugzquotationsfusetwos-complementshelvingsinglepageweb-site-projectcorbanlmelight-injectfaultwsclossless-compressiongamingxdt-transformformatsalesforceidispatchwcf-ria-servicesmemory-mapped-filesthreadxintel-edisonaccountmanagerc++03activex-documentsdefault-constructortargetbreadth-first-searchswcexittelephonytbbspritelowpass-filtersconsxaequality-operatornon-typememory-editingwinrt-xamllrculturetransactionaljob-schedulingfilesystemobjecthtml5-kickstartwireframesamlcontrol-structurequery-tuningapplication-layerw3cparticleintel-micpngraycastingcombinatorsemtransaction-loghtml-content-extractionperiodprivate-keysigilskolmogorov-smirnovcontext-boundx11documentation-generationdeclarative-programmingncursesunordered-mapbarcode-printingvalidationattributemod-perljavassistcaliburn.micromscapihttp-headerspyopenglazure-storage-blobswindows-embeddedcommercial-applicationcharacteristicsactionsimulinkgranularitycryptoapiprotocol-buffersocunitgreen-threadswindows-integrated-authpidscalatestprogressdialogscenariosdbunitpowershell-v4.0stubsedifacttypographycore-imagentpindexofasterisktfs2012resource-managementdata-consistencywinddknpmcoldboxhtml-listsilasmuicollectionviewnopcarouselcs50rdocsrandcross-correlationwindows-explorerfrebinstagram-apipostordervisualdesignerlexical-castmenuitemdynamic-arraysjava-ee-5dynamics-crm-4tildefile-sharingdjango-urlsoverusestored-functionsoptionscreateobjectbibtexrubymineironpythonqtableviewreducingnsdatamod-rewriteisoblobchomsky-normal-formwin32guitightly-coupled-codecomment-conventionsdocument-databaseoverwriteandroid-sensorsdespass-by-rvalue-referencelspictureboxcontractsactivesupport-concernuibuttonmethod-signatureinterpretationasp.net-controlsspell-checkingobject-oriented-perlstring-substitutionpowerbuilder-pfcwindows-95servercontrolspitchzseriestransitionsglkithornetqtype-providerspostsharpiommussdamazon-snsplaneweb-controlsautomatic-propertiesbrokertre-libraryspellingpygleteasyphpqthreadapproximationjcanvasstring-lengthhrefweb-farmmapkitmsysgithp-nonstopcontroltemplateslatitude-longitudesimplifyvoxeltesseractmulti-table-inheritanceproperties-fileioexceptionevent-storeobject-createclearcaseidocscriptmethod-chainingextreme-feedback-deviceshamcrestmongodb-queryida-prosurfaceviewdjango-ormprivate-constructorpromptvmallocumtsalunstimeintervaladtinter-process-communicatwifstreamhsqldbpcmdocumentdatabase-restoreviewresultspecializationdepth-first-searchestimotesuppress-warningswin64god-objectfaceboxavassetreaderhttpresponsemnesiaopenmpipetapocominikanrengeographical-informationvipsgotchasmongodb-csharpbundleexcel-formulamissing-datapageloadstrict-weak-orderingmapping-modelexcel-2007navigation-drawerkextrender-to-textureclojurescriptmodula-2directed-graphangularjs-serviceattsilverlight-3.0dftdemoservice-locatorcorrectnessperl-data-structuresboolean-expressionnuget-serverdecodinggsoapcase-insensitivenxtrfidlightingflowlayoutpaneldjango-admincircular-bufferunrealscriptjgroupsaudio-processinghiveabapvncside-effectsprofilerknnstatic-typingprotected-modefirst-order-logiccode-by-voiceansi-cdirectoryservicesinterpretedlocklessnsimageviewuicomponentsws-federationusernameowinurl-patternwmi-queryqsortcls-compliantaccelerate-frameworkformatted-inputsafety-criticalargument-deductionstring-comparisonservlet-containerexpectalterjxlheap-randomizationuseridextjs4shtmlrow-numberrelative-pathviewmodeloccasionallyconnectedpowermockfacebookeraudio-streamingpage-lifecycledeferredberkeley-dbnamed-entity-extractiondoubly-linked-listvertex-shaderfacetd2rails-routingrtpshortcutexpression-templatesindustrialwhmdaxbpmnstringtokenizerspreadsheetinitial-contextbuild-scriptscalaralexa-voice-servicepipelineray-pickinglinesazure-active-directoryimageviewresponsesetjmppolyhedraunificationmessagesarduino-idelagsqueakintervalssetfocusorchestrationnao-robotandroid-permissionsthrowjbpmtimeoutexceptionyarndeep-linkingone-to-manypipeliningidocrelative-addressingwildflystaruml.net-corepalindromeandroid-uixulrunnerduck-typingamazon-elbpingreverseperspectivecamerasql-server-2008-expresspixelmetatrader4variable-typesfoxproswingworkerxtsjekyllshared-nothingactionscript-2apkeaaccessoryhtml5boilerplatestatic-factorymmslibxml2swizzlingapache-spark-sqlpolynomial-mathphobosucmafgetccbirheightmapjoptionpanesublistflash-messagevlcaccessorsavonriscwebhttpyui3xjcdatabase-administrationfinite-state-machineopc-uamember-pointersmindstormsspring-profilesstructuremapprettyfacesdna-sequencecondition-variablejndiwcf-hostingbracespresentationcatalystjquery-tooltipobjective-c-categorynsisaplcreate-tableseriesnswindowcontrollerdatabase-replicationdecrementmathematical-expressionsviewbagitemgroupjboss-mdbdecltypesequentialfaceletsrepeatsdl-2real-modedo-whileext4sitedesignprolog-difc-librariesiis-6context-sensitive-grammarflowthe-little-schemershiftia-32sybaseseeklog4jqt-designerreactiveuisftpnsregularexpressiondbcontextadjacency-matrixtracingbuild-systemcartesianchannellinux-distrosehc++-conceptsroslynhadoop-streamingrgsdirent.hvsewsspartial-specializationamazon-s3netshpatchboost-asiolow-memoryserialversionuidrs485visual-web-developerinputstreamvisual-studio-2003image-conversiondelphi-6dotnetnuke-imcmit-schemeentitymanagersignalrunique-constraintlocalstokenizeplpythonchunkingboost-anycpu-speedpage-tablesfilteringinformation-hidingshapefileyasmfractionscpancasevirtual-destructorobject-pascalsql-server-2014event-based-componentseclipse-gefverificationdepth-buffertext-extractionrelaycommandorientdbembedded-languagenotifyhypertalkpci-emarklogiccartographyaddsubviewjbuttonsuspendmach-o.net-micro-frameworkcatalogsts-springsourcetoolsuitemasterstellentcss-specificitylevelsconnectionssandcastleurllibldpresenterchicagobossprototype-programmingduplicate-removalcmake-guitype-systemsdocument-readyuuidconnectrecurrencesublimetext2firebirdjquery-effectsappiumoauthis-emptyfind-by-sqlhypermedia3d-modellingusergroupsvnc-serverroguelikesuperclassinsightbusdynamic-scopefunction-templatesandroid-mapviewbytebufferfunction-pointsrights-managemententity-framework-4.3identity-mapspatial-indexfibonacci-heapstatementswhite-boxopencmsdatabase-agnosticnetmodulessparcdecompilerarmcccakephp-2.0azure-web-rolespikecross-productlotus-notesnspredicaterobotandroid-navigationviewps3securityexceptionappdomainblendersql-scriptsdemoscenefancyboxextendspiautomated-deploymentnoscriptdxgitouch-typingjava.util.scannerpython-3.3django-staticfilesgenerative-artpci-dsscancurryingnonetypesql-execution-plantaggingambaatomicitymotion-planningaccurev6510adhoc-queriesmongodb-rubycircular-listsystem-requirementsforumshidden-fieldframehttp-getwavec++98cap-theorembiological-neural-networkautoclassoracle9iclass-visibilityfile-readfluidurwidzend-formhostnamewindows-shellresolutionandroid-dialogreducersitanium