We analysed more than 40 000 000 questions and answers on stackoverflow.com to bring you the top of most mentioned books (5720 in total)

How we did it:

  • We got database dump of all user-contributed content on the Stack Exchange network (can be downloaded here)
  • Extracted questions and answers made on stackoverflow
  • Found all amazon.com links and counted it
  • Created tag-based search for your convenience
  • Brought it to you

For any feedback, any questions, any notes or just for chat - feel free to follow us on social networks

Recomended tags

Top mono books mentioned on stackoverflow.com

Mastering Regular Expressions

Jeffrey Friedl

Regular expressions are an extremely powerful tool for manipulating text and data. They are now standard features in a wide range of languages and popular tools, including Perl, Python, Ruby, Java, VB.NET and C# (and any language using the .NET Framework), PHP, and MySQL. If you don't use regular expressions yet, you will discover in this book a whole new world of mastery over your data. If you already use them, you'll appreciate this book's unprecedented detail and breadth of coverage. If you think you know all you need to know about regular expressions, this book is a stunning eye-opener. As this book shows, a command of regular expressions is an invaluable skill. Regular expressions allow you to code complex and subtle text processing that you never imagined could be automated. Regular expressions can save you time and aggravation. They can be used to craft elegant solutions to a wide range of problems. Once you've mastered regular expressions, they'll become an invaluable part of your toolkit. You will wonder how you ever got by without them. Yet despite their wide availability, flexibility, and unparalleled power, regular expressions are frequently underutilized. Yet what is power in the hands of an expert can be fraught with peril for the unwary. Mastering Regular Expressions will help you navigate the minefield to becoming an expert and help you optimize your use of regular expressions. Mastering Regular Expressions, Third Edition, now includes a full chapter devoted to PHP and its powerful and expressive suite of regular expression functions, in addition to enhanced PHP coverage in the central "core" chapters. Furthermore, this edition has been updated throughout to reflect advances in other languages, including expanded in-depth coverage of Sun's java.util.regex package, which has emerged as the standard Java regex implementation.Topics include: A comparison of features among different versions of many languages and tools How the regular expression engine works Optimization (major savings available here!) Matching just what you want, but not what you don't want Sections and chapters on individual languages Written in the lucid, entertaining tone that makes a complex, dry topic become crystal-clear to programmers, and sprinkled with solutions to complex real-world problems, Mastering Regular Expressions, Third Edition offers a wealth information that you can put to immediate use. Reviews of this new edition and the second edition: "There isn't a better (or more useful) book available on regular expressions." --Zak Greant, Managing Director, eZ Systems "A real tour-de-force of a book which not only covers the mechanics of regexes in extraordinary detail but also talks about efficiency and the use of regexes in Perl, Java, and .NET...If you use regular expressions as part of your professional work (even if you already have a good book on whatever language you're programming in) I would strongly recommend this book to you." --Dr. Chris Brown, Linux Format "The author does an outstanding job leading the reader from regex novice to master. The book is extremely easy to read and chock full of useful and relevant examples...Regular expressions are valuable tools that every developer should have in their toolbox. Mastering Regular Expressions is the definitive guide to the subject, and an outstanding resource that belongs on every programmer's bookshelf. Ten out of Ten Horseshoes." --Jason Menard, Java Ranch

More on Amazon.com

CLR Via C#

Jeffrey Richter

Your essential guide to developing applications with the common language runtime (CLR) and Micrsoft.NET Framework4.0, with examles in Microsoft Visual C # 2010.

More on Amazon.com

Cocoa Programming for Mac OS X

Aaron Hillegass

A revision of the highly acclaimed introduction to Cocoa programming, updated for Mac OS X Leopard.

More on Amazon.com

Programming Microsoft ASP.NET 2.0 core reference

Dino Esposito

Build your expertise as you move beyond the basics—and delve into the core topics of programming with ASP.NET 2.0. Useful to both experienced developers and those developing new skills, this ultimate reference is packed with expert guidance, hands-on programming instruction, and practical examples to help you advance your mastery of developing applications for the Web. Discover how to: Author rich, visually consistent pages and manage layout with themes and Master pages Create personalized pages that persist user preferences Retrieve, modify, and manage data with Microsoft ADO.NET Configure the HTTP pipeline to serve ASP.NET 2.0 pages Control program flow by tracing and handling exceptions Design caching layers and learn state management techniques to optimize application performance Manage users with membership control, registration, and authentication capabilities Build real-world data access layers using common design patterns Use custom collections with data source controls Learn the internals of grid controls PLUS—Get code samples on the Web

More on Amazon.com

Concurrent Programming on Windows

Joe Duffy

This practical book includes a tutorial of the entire set of Windows and .NET APIs required to write concurrent programs. Because so much of the threading and synchronization features of the platform are Windows-general, the author, Joe Duffy, focuses first on the general behavior and then on the API details of native and managed code. Interspersed among the tutorial are many difficult-to-discover, useful insights, and internal details about how things work.

More on Amazon.com

C# 3.0 in a nutshell

Joseph Albahari, Ben Albahari, Peter Drayton

Offers a reference to key C# programming concepts covering language elements, syntax, datatypes, and tasks.

More on Amazon.com

Microsoft Certified Technology Specialist Self-paced Training Kit (exam 70-536)

Tony Northrup

Your 2-in-1 Self-Paced Training Kit. Fully updated and revised! Ace your preparation for the skills measured by MCTS Exam 70-536—and on the job. With this official Microsoft study guide, you'll work at your own pace through a series of lessons and reviews that fully cover each exam objective. Then reinforce and apply what you've learned through real-world case scenarios and practice exercises. Maximize your performance on the exam by learning to: Develop applications that use system types and collections Validate input, reformat text, and extract data with regular expressions Create services and multi-threaded applications Implement code-access security and role-based security Implement serialization to read and write complex objects Leverage legacy code using interoperability Monitor and troubleshoot applications Create applications for a global audience PRACTICE TESTS Assess your skills with practice tests on CD. You can work through hundreds of questions using multiple testing modes to meet your specific learning needs. You get detailed explanations for right and wrong answers?including a customized learning path that describes how and where to focus your studies. Your kit includes: 15% exam discount from Microsoft. (Limited time offer). Official self-paced study guide. Practice tests with multiple, customizable testing options and a learning plan based on your results. 300+ practice and review questions. Code samples in Microsoft Visual Basic and Visual C# on CD. Case scenarios, exercises, and best practices. 90-day evaluation of Microsoft Visual Studio Professional 2008. Fully searchable eBook of this guide. A Note Regarding the CD or DVD The practice test materials are available as a download along with your ebook version of the kit, and will be located in your account. Please direct any questions or concerns to booktech@oreilly.com.

More on Amazon.com

OS X and iOS Kernel Programming

Ole Henry Halvorsen, Douglas Clarke

OS X and iOS Kernel Programming combines essential operating system and kernel architecture knowledge with a highly practical approach that will help you write effective kernel-level code. You’ll learn fundamental concepts such as memory management and thread synchronization, as well as the I/O Kit framework. You’ll also learn how to write your own kernel-level extensions, such as device drivers for USB and Thunderbolt devices, including networking, storage and audio drivers. OS X and iOS Kernel Programming provides an incisive and complete introduction to the XNU kernel, which runs iPhones, iPads, iPods, and Mac OS X servers and clients. Then, you’ll expand your horizons to examine Mac OS X and iOS system architecture. Understanding Apple’s operating systems will allow you to write efficient device drivers, such as those covered in the book, using I/O Kit. With OS X and iOS Kernel Programming, you’ll: Discover classical kernel architecture topics such as memory management and thread synchronization Become well-versed in the intricacies of the kernel development process by applying kernel debugging and profiling tools Learn how to deploy your kernel-level projects and how to successfully package them Write code that interacts with hardware devices Examine easy to understand example code that can also be used in your own projects Create network filters Whether you’re a hobbyist, student, or professional engineer, turn to OS X andiOS Kernel Programming and find the knowledge you need to start developing What you’ll learn OS X and iOS common core architecture How to write extremely efficient code by exploiting kernel details Coding kernel-level extensions How to write device drivers How to program the I/O Kit framework Key mobile device topics like power management drivers and video capture modules To understand OS X memory management and threads To parse kernel debug messages and package projects ready for deployment Who this book is for This book is suited for: Intermediate and advanced iPhone and OS X programmers ready for the next step Kernel-level programmers interested in how OS X and iOS function Open source programmers with a background in Linux or BSD, OS X and iOS Programmers interested in application performance System administrators running OS X clusters Table of Contents Operating System Fundamentals Mac OS X and iOS Xcode and the Kernel Development Environment The I/O Kit Framework Interacting with Drivers from Applications Memory Management Synchronisation and Threading USB Drivers PCI and Thunderbolt Power Management Serial Port Drivers Core Audio Network Drivers Storage Drivers and Filesystems User-Space Drivers Debugging and Profiling Advanced Kernel Programming Deployment

More on Amazon.com

The Common Language Infrastructure Annotated Standard

James S. Miller, Susann Ragsdale

bull; bull;Jim Miller is an extremely influential figure in the computer science world. He is the lead of the CLR team at Microsoft, and the editor of the CLI standard for the ECMA bull;Contains proprietary annotations and samples from Microsoft and the ECMA not available anywhere else bull;There is no other book like this on the market or in the works

More on Amazon.com

F# for Scientists

Jon Harrop

"This work strikes a balance between the pure functional aspects of F# and the object-oriented and imperative features that make it so useful in practice, enable .NET integration, and make large-scale data processing possible." —Thore Graepel, PhD, Researcher, Microsoft Research Ltd. Over the next five years, F# is expected to become one of the world's most popular functional programming languages for scientists of all disciplines working on the Windows platform. F# is free and, unlike MATLAB® and other software with numerical/scientific origins, is a full-fledged programming language. Developed in consultation with Don Syme of Microsoft Research Ltd.—who wrote the language—F# for Scientists explains and demonstrates the powerful features of this important new programming language. The book assumes no prior experience and guides the reader from the basics of computer programming to the implementation of state-of-the-art algorithms. F# for Scientists begins with coverage of introductory material in the areas of functional programming, .NET, and scientific computing, and goes on to explore: Program structure Optimization Data structures Libraries Numerical analysis Databases Input and output Interoperability Visualization Screenshots of development using Visual Studio are used to illustrate compilation, debugging, and interactive use, while complete examples of a few whole programs are included to give readers a complete view of F#'s capabilities. Written in a clear and concise style, F# for Scientists is well suited for researchers, scientists, and developers who want to program under the Windows platform. It also serves as an ideal supplemental text for advanced undergraduate and graduate students with a background in science or engineering.

More on Amazon.com

Practical Mono

Mark Mamone

Practical Mono offers a detailed portrait of Mono and its many facets. You’ll learn about building GUI-based applications with Gtk#, database interaction with ADO.NET, and powerful applications with XML and web services. By embracing this implementation, you can take advantage of the powerful development paradigm, building Internet-enabled cross-platform applications based on open source technologies. This book includes a primer on C#, so even if you’re a novice .NET programmer, you will still gain plenty from this practical guide.

More on Amazon.com

Developing C# Apps for IPhone and IPad Using MonoTouch

Bryan Costanich

Everyone wants to write iPhone Apps-even those .NET developers who love writing in C#-and the introduction of Applers"s iPad only makes the desire that much greater. Fortunately, therers"s MonoTouch, Novell's .NET library that allows C# developers to write C# code that executes in iPhone OS! Furthermore, MonoTouch allows you to address all the unique functions of the iPhone, iPad touch, and iPad. And the big plus...? You neednrs"t learn any Objective-C to master MonoTouch! Former Microsoft engineer Bryan Costanich shows you how to use the tools you already know to create what look just like native Apps in iPhone OS. The magic is in Novellrs"s implementation of Apple's Cocoa libraries in MonoTouch. Essentially, yours"ll master the same elegant and rich Cocoa environment, but without the need to learn a new programming language. Developing C# Applications for iPhone and iPad using MonoTouch takes you from your first Hello World example through the major APIs and features of the iPhone OS.

More on Amazon.com

Mono

Edd Dumbill, Niel M. Bornstein

Includes Gtk#, MonoDevelop, Web services, and IKVM.

More on Amazon.com

Cross-Platform .NET Development

Jason King, Mark Easton

.NET is not just for Windows anymore! This unprecedented book examines the advantages of building portable, cross-platform.NET code. Even if you are only vaguely familiar with .NET, with the aid of this book, you’ll quickly learn how to run .NET code on different platforms. You may run code among the Linux, Unix, Mac OS X, and Windows platforms. And you'll get to choose among Mono (for Linux), Portable.NET (for Mac OS X), and of course, .NET for Windows. What’s more, authors Mark Easton and Jason King pack the book with example code and wisdom, providing you a well-rounded skill set. Based on years of personal .NET experience, the authors share years of expertise—dos, don'ts, pitfalls, gotchas, and insights in the convenience of a single, handy book.

More on Amazon.com

Mono Kick Start

Hans-Jürgen Schönig, Ewald Geschwinde

After a classically structured crash-course on the C# language and Mono's own compiler, the authors reach down deeper to subjects like threads, network programming, security, database interaction, XML, and more.

More on Amazon.com

javac#c++c.netalgorithmphppythonjavascriptdesignasp.netlanguage-agnosticdesign-patternsandroidoopsqllinuxdatabasematharchitectureperformanceprogramming-languagesresourcesuser-interfacemysqlhtmlsql-serverwindowsiphonerubyiosmultithreadingdata-structuresresearchobjective-csecuritycomputer-scienceassemblyruby-on-railsjquerydatabase-designdocumentationasp.net-mvcunit-testingrcompiler-constructiontestingunixcsssoftware-engineeringwpfartificial-intelligenceweb-applicationsvb.netreferenceclassvisual-studioweb-servicesoptimizationarraysnetworkingproject-managementjava-eeumleclipseosxcoding-styleagilegraphicswinformsoperating-systemmemory-managementoracleembeddedspringwinapivisual-c++image-processingmodel-view-controllerajaxhardwareparsingfunctional-programmingregexamazonmemorytddtheoryinheritancefunction3dstatisticsperlopenglkernelopen-sourcexcodeapistringnlpxmlcocoawcfentity-frameworkdebuggingmachine-learninginterfacerefactoringactionscript-3concurrencymatlabrestdomain-driven-designdelphic#-4.0stlgraphpointersnode.jsscriptingopengl-estemplatessharepointidelispsilverlightdjangoprocessparallel-processingamazon-web-servicesuntaggedcommand-linex86scalasocketssql-server-2008visual-studio-2008frameworkshtml5audioobjectlistneural-networkproject-planningvb6visual-studio-2010flexswinglinux-kernelstandardslogicproductivitysearchencryptionc++11mobilec++-faqqtscrumgccscalabilityf#genericsmfcflashhaskelltsqlsortingsoftware-designversion-controllinqsql-server-2005treeweb-scrapingterminologyimagemethodologyasynchronousvbaxamlvariablesshellasp.net-mvc-3boostexcelooadopencvusbcryptographyc#-3.0eventsphysicstypesapachepluginsnetwork-programminghibernatetcpclojurematrixsyntaxmethodsssasrecursionsignal-processinggeometrycachingfortranpostgresqlcocoa-touchdependency-injectionschemestackipadgame-enginefileclass-designauthenticationinterpreterdeploymentarduinomodelruby-on-rails-32djsondirectxbluetoothfrontendusabilityspring-mvccomputer-visionformslambdasoawebinternalscollectionslinux-device-driverfilesystemsejbexceptionnhibernatevectorqadllcomlanguage-design.net-3.5linq-to-sqlvideogarbage-collectionhttpembedded-linuxjvmsqlitenaming-conventionssystembashimplementationmvvmtimezend-frameworkwebsitebddjspdata-access-layerthread-safetyscientific-computingvalidationindexingjunitosdevmockingopensslconstructorgrailsuser-experiencexpathreal-timerelational-databasecompilationmodelingtextmongodbdata-modelingormextreme-programmingprotocolsdevelopment-environmentprojectwebformsanalysisposixlow-levelclient-serversingletonservletsdata-miningsynchronizationclrcomparisonlanguage-featuresamazon-product-apimonocommon-lispmicrocontrollercontinuous-integrationhadoopxnacomplexity-theoryasp.net-mvc-4diagramcudasimulationencapsulationrandomhyperlinkdommacrosmusicshaderprojectsgwtjoinms-accesse-commercelinked-listwindows-phone-7linkerbinarydictionarystaticanti-patternscontent-management-systempolymorphismloopsstructurevisualizationstructactionscriptjpasvndata-warehouseabstract-classgroovyclosurescss3distributedprologtfsexception-handlinganimationdynamic-programmingdiscrete-mathematicssocial-networkingiorepository-patternif-statementcpuhashautomated-testssslkeyboardcode-reviewdynamicmetaprogrammingseleniumeclipse-pluginestimationheapgenetic-algorithmcode-generationlockingclassificationolapdrupalroboticsreverse-engineeringspecificationscomputational-geometryazurenormalizationmemory-leaksdriverssisopenclprofilingopengl-es-2.0grammarraspberry-picastingjava-meelectronicsmsbuildpthreadsarmxhtmlscreen-scrapingpropertiescanvastomcatuser-interactionrenderingpython-3.xstored-proceduresinputnullandroid-ndknosql.net-4.0scopeplsqlhistorydevice-drivervhdlios5pattern-matchingmessagingrequirementscommentscpu-architectureubuntujsfcommunicationasp.net-ajaxnunitipcinversion-of-controldesign-principlesclouderlangdefinitionworkflown-tierxsltnamespacesmoduleblogssolid-principlessharepoint-2010gitgpudelegatesextjsdatasetlayoutsoaphigh-availabilityfftmakefileintegration-testingparameterscomputer-architecturenetbeansswiftruntimereporting-servicesquery-optimizationlegacygoogle-app-engineios4windows-7pocograph-theorydsltransactionsasp-classicautomationconfigurationsharepoint-2007workflow-foundationuse-caseinitializationfacebookreflectionbuttoniteratorado.netbig-odata-visualizationtimerbuildfull-text-searchactiverecordoperator-overloadingandroid-layoutcallbackjnibit-manipulationsymbianturing-machinesx86-64csvangularjsmigrationsdkconventionsexcel-vbajavafxtext-miningserializationerror-handlingbusiness-intelligenceannotationsbiztalkaopssl-certificatecucumberappleidiomaticmutexocamlcoldfusionrotationfinancebuild-processcore-dataincludedesktopfor-loopformal-verificationkinectbluetooth-lowenergyvimmapgpgpuwindbgasp.net-2.0constants.net-2.0global-variablesmultiple-inheritanceiisdownloadsrpentityreportingeditorknapsack-problemprocessordatetimemavenjbossswitch-statementcode-organizationchartsmallocbisonpkiimmutabilityloggingsoftware-qualityenumsmipsfirmwarecode-coverageserial-portseparation-of-concernscodeigniteralgebraintegrationc++-clischedulingmetricsoperatorsglassfishrspeccompressionxcode4procedural-programmingpdfcameraosgientity-framework-4.1printfcode-metricsyacclicensingfinite-automatafile-ioserviceopengl-3mdxhtml-parsingload-balancingtime-complexitycross-platformurlsignalspersistencelexwindows-8verilogunicodereadabilityportingnew-operatorwolfram-mathematicagame-physicsmapreducemulticorewhile-loopc#-2.0vm-implementationcakephprsavisual-studio-2005nestedc99colorsgdbbinary-treenamingbuild-automationcocos2d-iphonepython-2.7asp.net-mvc-2floating-pointoverloadinginternationalizationcilinformation-extractioncompiler-theorybrowserpowershellconstforeign-keysjsf-2time-managementmessage-queuehciblackberrynetwork-protocolsglslencodingsaasopengl-4uitableviewudpilgembsdmultidimensional-arraystatic-methodswebglidiomscertificateaesioc-containerrtoslocalizationadaptercurlbeautifulsoupintegermanualtask-parallel-librarystreamclient-sidelatextaskswtautomataphpunitmoqatomicejb-3.0expression-blenddnsclientawtreviewsql-server-2012terminalpseudocodelinear-algebrapass-by-referencecontact-formcqrsweb-crawlercode-smellstrategy-patternexpressstatedriverspublic-key-encryptionvisual-studio-2013prototypeevolutionary-algorithmbackbone.jsspeech-recognitiondrawingosx-snow-leoparduser-controlssemantic-webselectentity-framework-4booleanpermissionsbioinformaticspsychologyvisual-studio-2012heuristicsrdbmslucenesteganographyjsoupaugmented-realityinterruptpair-programmingcallscrapecompact-frameworkbindingtime-seriesinteropdata-accessglutraytracingdependenciesfactorydevicewarningstemporal-databaseseoreturn-valuedevelopment-processnumbersfactory-patterndistributed-computingsmltransitionjdbcjerseytext-editorlaravelbusiness-logicsessionpattern-recognitionfiltersystem-callscontrollerthreadpooloutlooksql-server-2000jitsetasp.net-web-apiwordpresscdimemcachedbytecodestate-machinesbitmapunity3dmathematical-optimizationrmibrancharraylistopenmpcomponentsconditionalsicpluagame-theorythisocrbiztalk-2010jquery-mobileevent-handlingactivexsyncarchitectural-patternsxsdsynthesispathatlnumerical64bitcode-snippetsassertbinary-search-treeinsertrazorsasjoomlanfcinternalxunitcoordinatesemacsui-designcompiler-errorssamplevirusdatamodelteamworksystems-programmingjiracontext-free-grammarawkstdschemadatehttpssolrgraphic-designandroid-activityvirtual-memoryauthorizationgrepsmart-pointersesbcopybatch-fileiterationvirtual-functionsasync-awaitninjectconditional-statementscgiprimitivefunctorrelease-managementrequestapi-designstatic-analysisassertionsphotoshopstylesorderdatabase-schemaactordiscoveryabstractionwindows-cebuffereclipse-rcpmvpbuffer-overflowantoracle11gdatabase-connection.net-3.0windows-mobileclass-diagramtraitsrssquartz-graphicscvsshopping-cartbigdatamvvm-lightfpgaroutingef-code-firstphysics-enginegdicobolprobabilitytelecommunicationsegmentation-faultsharepoint-brandingtimeoutwebsocketsemaphoredaemonjava-ee-6akkacrashhashmapmysqliobserver-patterndsl-toolscapacity-planningdesktop-applicationwindows-xpiis-7batterysql-server-2008-r2attributesmetadatacluster-analysisevent-drivencompile-timedifferential-equationssql-injectionprojects-and-solutionsexploitversioningdaohashtablegnuobject-oriented-analysisload-testinglambda-calculusidisposablerdfmongrelcollision-detectionportsymfony2consolefault-toleranceggplot2jpegc++14performancepointviewcompiler-developmentgraph-algorithmyiiregressionargumentstfs2010qt4loginwtlpublish-subscribemodularityimportmontecarlomousequeuekernel-modulesearch-enginelock-freecode-analysisreference-manualprotectedcustom-controlsinstanceguidcontrolsrepositorycompiler-optimizationrestful-architecturecsprojstrutsmonodevelopcalculatormiddlewarefuzzy-logicdojodatabase-performancerunnabledrupal-7business-logic-layercode-contractsprintingxamarin.iosxpagesnativeshared-memorysharepoint-designerautomated-refactoringmudtry-catchwcf-data-servicesequationpygamekr-cbinary-searcht4smalltalkrelationalwirelesss4race-conditionpackage-designbenchmarkingcharacter-encodingheader-filesasp.net-mvc-routingdatamapperinline-assemblydoubleheaderlanguage-theorylabviewanalyticsdata-analysisvisual-sourcesafemarkovtranslationtypedefstack-overflowcore-animationjmsdirectoryundefined-behaviorvalue-typesynchronizedlucene.netlegacy-codecpu-registersfsmmpifunctional-testingarticlelibrariesdata-bindingoracle10grecommendation-enginesencha-touchapplyuikithidden-markov-modelsgocore-bluetoothfreebsdextensibilityprimary-keymlrcpdisposeresharpersdlcforkneo4jsimple-html-domworkflow-foundation-4rich-internet-applicationcode-access-securityhalting-problembibliographyunity-containerpaginghashcodescreendcomwixp2ptokenddd-repositorieskeyboard-shortcutscordovajavascript-eventselfbug-trackingscjpwindows-servicesapp-storecore-graphicsflaskmonitoringresponsive-designffmpegqt-creatorbigintegercompositionjava-7denormalizationasmxconventionlayersiliconbpmc-preprocessorreturn-typevb6-migrationlinq-to-xmlnumerical-methodsformattingplayframeworkapplication-planningentity-attribute-valuepriority-queueironrubytestcasesymbolspredictionredminemaintenancecomputation-theoryprojectionmaintainabilityforms-authenticationdatabase-partitioningpuzzleobfuscationbehaviorms-wordwebcamred-black-treetwittercommand-line-interfacedomain-modelinformation-retrievalimage-manipulationgenetic-programmingxquerymany-to-manyui-guidelinesreleasevideo-streamingc++-standard-libraryassignment-operatorergonomicslinq-to-entitiesosx-leoparddrycontainersmockitohidden-featureslexical-analysisadvertisingviewssnmpequalsejb-3.1oltprolesjunit4kinect-sdkrhino-mocksdirectx-11identitydisassemblingwinsockcfmlequalityaccelerometern-tier-architectureglobalizationtfsbuildsemanticsprivateui-patternsorganizationaggregationgetsizeprototypal-inheritancecalendarreplacemyeclipsepermutationnantscripting-languageactive-directoryvstoruby-on-rails-4function-pointersdesign-timelazy-evaluationperformance-testingwindows-phoneconstraintsstress-testingwebviewbnfserver-sideruby-on-rails-pluginssql-server-expressgoogle-chrometagssilverlight-4.0flex4.5packetiostreamprecisiontwistedhierarchical-datainformixmobile-websitesinatrainferencewaitb-treedumpallocatorpersonal-software-processaccessibilitymixinsshared-ptrantlrspatialflex4pipescalingtriggersgethashcodeassociative-arrayenterprisesystem-designcontinuous-deliverygrizzlypaypalcmdappceleratorscrapycouplinglistboxvisual-studio-2015passwordsamazon-ec2nonblockingfreenutchfuturecruisecontrol.netsyntax-errorbayesianimage-recognitionansi-sqlsvmpreprocessorfractalsdeadlockethernetfatbytecpu-cachescipyoverflownamed-entity-recognitionutf-8cassandraparser-generatorechokindle-fireformal-languagesspectrumienumerabledomainservicesmessagedynamics-crmrulescounthigher-order-functionssubstringmasmnotationblockingunions2d-gamesvocabularyraspbianfibonacciadalexercapybaraoracle-adfagile-processeskey-bindingsnservicebustornadoentity-framework-5simdfontsinner-classeswindows-ntregular-languageimperative-programmingthree.jsvideo-game-consolessmartphonedatagridviewreportflash-cs3hashsetsseusingastronomyface-recognitiongettercastle-windsorinterrupt-handlingcode-formattingerbcritical-sectiongetter-setterldapprivate-membersmapsaggregatenumerical-analysisgradleintlow-latencymoduloxlibdirected-acyclic-graphsconnectionvoting-systemjava-2dtclbootloaderstring-matchinginterpreted-languagetkinteramazon-mwsteamsystemciderweb-apierddeliverywmikeywordxmppramgeneratordtowcf-securitypokerbindflex-lexercore-audioprototypejsfriendplatformlinguisticsframebufferexpressionnamed-pipestablestublanguage-lawyerlinear-programmingshared-librariespackageoverridedistanceexerestful-authenticationpojolocalwindows-installernavigationhbasegoogle-chrome-extensionincrementxunit.netviewstategrand-central-dispatchiocpcontinuous-deploymentchildrenhangselenium-webdrivermobile-phonesmaven-2uiviewxssdirect3dfortran90csladuplicatessumpublic-methodwindows-store-appsproofyuiredmine-pluginsvirtualizationwindowvoicesingle-sign-onsql-azureiphone-sdk-3.0phpmyadmindrupal-6asymptotic-complexitygpsnormalizingregistrycodebasehostingcrash-dumpsremotingfinalizernotificationsperforceglobalexecutablesubclassconways-game-of-liferaiidatacontextbotspostindentationtext-processingtaocpcorrelationalsahookcubessednasmreplicationdfalocalereactjsvariable-assignmentdynamic-languageshuman-computer-interfaceinformation-theoryracketversionsvideo-capturetemplate-meta-programmingfactory-methodcode-injectionhdmiasp.net-membershipoctaveplotapplescriptwifibit-shiftcom-interopmainframeetlprototype-patterncollisioncellular-automatahierarchyansiprimitive-typesbitwikiscanfstylesheetmarkov-chainsmountenumerationcode-duplicationfieldbackgroundasp.net-3.5debianequivalencemenuemgucvode.net-assemblydrupal-modulespaginationlarge-datatemplate-specializationpredicatejenacallstackloaderpreg-replacechessrewritejax-wscmakefluent-interfacereliabilitygeospatialself-hostingvirtual-address-spacethree-tierbitvectordiagrammingowlkindlemulti-tenantjoglhidwebpagesettermedia-queriesgoogle-glassgeographymedicalclassloadermultiplayermd5generic-programmingeffective-c++distributed-systemexecforeachnoiseshellcodeobd-iivalue-objectshdlpddlcrc32emailtext-analysisruby-on-rails-3.2xslt-1.0compositenvidiatail-call-optimizationsolarisgroupingparentheseswicketipv4sipclipscategory-theorymstestminimizationgsmwindows-vistafopasp.net-4.0programming-paradigmsrubygemsmanaged-directxequinoxlensdijkstrajpa-2.0memory-addressrakecoffeescriptzoomwiresharkgdcompiler-warningsaccess-specifierdependency-propertiestarget-frameworkjquery-pluginswekamemory-barriersmetalandroid-emulatorautomakeopencvdotnetdreamweavervisitoradobefirefoxinstallationtelnetdeprecatedcomposite-componentgoogle-apirestletkernighan-and-ritchieflex3wifclickliteralsclangdosnameslanguage-constructcometstylecopsimulated-annealinghandwritingmicroservicesroutessvgfacebook-fqlembedn-gramroundingforecastingtransformline-of-business-apptooltippromisemarkupdecimalgalleryredundancycompareusing-statementdocx509loadallocationreinforcement-learninggdi+fluid-dynamicspointtuplesabstract-syntax-treesysadminweb-standardsjvm-languagestic-tac-toerankingisolation-levelacidnltk6502midiuser-storiesubuntu-9.04birtdashboardfile-uploadphotosustainable-pacerelationshipjfreechartftpfailoverclusterlibcdestructordeclarationerpsqlite3nginxriad3.jsuiimageviewdesign-by-contractvbscriptcronanemic-domain-modelfinancialrailoprerequisitespartitioningxcode4.2interpolationnsstringbootstrappingjesspolymorphic-associationsprotegeenterprise-libraryprivate-methodstail-recursionetiquettewhitespacequicksortlme4powerpointsizeofdefensive-programmingsyntax-highlightinglistviewbasentfsbridgerule-engineio-completion-portslxmljythontransactionscopegui-designstandard-libraryblazedsproceduremayamacrubycomplex-numbersdhtmltextmatenp-hardalt.netstar-schemasystem.reflectioncohesionfortify-sourcepimpl-idiomxcode5java-8twitter-bootstrapcurrencymsmqtextboxntosx-mountain-lionsmlnjinventoryelispwebservernsmutablearraydynamic-memory-allocationradsimilaritybiosdialognokogiriandroid-fragmentsstoragecurve-fittingtips-and-tricksg++cubedotnetnukelalrgpu-programmingxcode4.4multi-tierinstantiationinfinite-looppackagesbookmarkslotus-dominoemulatortemplate-method-patternkohanagroup-bycookiesms-officevarflashdevelopmicro-optimizationtoolkitlinear-regressionfxcopraspberry-pi2uiviewcontrollerdctsystem.drawinglow-level-codecopy-constructorsoapuirecurrence-relationdrag-and-dropservicebussemantic-analysispalm-osgototemporalpyqturiairwindows-8.1bitwise-operatorsaffiliatemicrosoft-test-managerrelational-algebraprinciplesqtranslatepuppetsoundexterraingridworldcomboboxc89quaternionsvolatilegoogle-apps-scriptlinq-to-objectscomputation-expressiontype-inferenceonion-architecturetortoisesvnmachine-codespark-view-enginedelphi-2007spring-securityconcurrent-programmingprismwaterfallcombinationschatqmlapache-sparkidlcode-reusesystem.reactiveinnovationsigintassembliesbackendgnomejax-rsgraph-databasesoverload-resolutionsecure-codingwindows-runtimerupcodeblocksibeaconcarbontaskmanagermainpath-findingcrystal-reportsbusiness-objectscontactsxcode4.5ecmascript-5productedaunit-of-workdomain-objecteconomicsolap-cubesimulatoreaidata-storagedata-annotationslookup-tablescinboundarymodal-dialogrecursive-querynokiawhere-clauseclouderavectorizationdjango-modelsrabbitmqnumpystdinocpjppart-of-speechaccess-modifierstitanium-mobileuser-defined-functionsrecvrichtextboxjvm-hotspotscheduled-taskscrmfactorialamazon-appstoremaster-pagesautocompletevsxsetup-projectacepandasblackberry-eclipse-pluginspam-preventionbpelspeechurl-routingmingwlspimplicit-conversiongraphical-programmingbuildersdljaxbfile-get-contentssymbolic-mathprocessingdweblogicmatplotlibshapewindows-phone-8java.util.concurrentmongoidgoogle-cloud-datastoresimple-injectorintersectionaspectjvidimensional-modelingbayesian-networksmouseeventcovarianceconsole-applicationttymultiplatformpascallibusb-1.0time-estimationbotnetcomputationclustered-indexhorizontal-scalingenvironmentjbehavewindows-server-2003msbuild-taskwordpress-themingjenkinsmsdnnaturallyspeakingpdoandroid-intent.htaccessclickoncerecursive-descenttrigonometrycom+returnmalware-detectiondecouplingmandelbrotmongoosemachine-languagellvmdelphi-xemultiplicationtraversalscoringblueprint-cssbreeze-sharpp-npmath.hmasstransittegraspring-batchlaravel-4liftcamera-calibrationmicrosoft-commerce-serverconceptualalicedecompilingddddnested-classoperator-precedenceruby-1.9ssclifinalcolor-schemerenamewrapperjulia-langnew-projectdefaultinnodblongjmpgoogle-closurecython32feetabaddressbookpdeautofacspecszosprimespylonsmochaherokuiscsiyagnismartyazure-storage-queuesshallow-copystdioaddtemporarysystem.outflash-cs5kanbanscriptletbroad-phasecustom-componentsbclscala-2.10gesture-recognitionscreenshotjoomla-extensionsputtracecubic-splinewebservices-clientrailstutorial.orgeffectsautowiredwcf-configurationacceptance-testingsamsung-mobilemodularinverse-kinematicsmodule-patternselenium-rccollective-intelligencetreeviewtemplate-matchingdtdnetduinobounded-contextsirvine32gtkcustom-actionjdeveloperclr-hostingwhite-hatdirectx-9dialectweb-partsdatagramentity-relationshipxbox360nintendorecordercomputabilitygoogle-visualizationzend-framework2directcomputephp-extensiondynamic-websitesgoogle-closure-compilermergesortacsjailbreakcontroltry-with-resourcestouchscikit-learngfortranpos-taggersubquerymsbuild-4.0language-switchingcommand-line-tooljmockjfifmember-functionsreference-countingdesign-decisionslistfieldios-simulatorcore-data-migrationwindows-authenticationupdatepanelquotingurl-rewritingpowerpoint-vbasts-securitytokenserviceevent-sourcinginstructionsrequirements-managementvisioaccountinggherkinimplicitsurvival-analysissql-order-byraphaeldata-compressionat-commandskip-listsrecordingaudiounitscrummasterarduino-unoobject-recognitionmonadsdroolsthrowawaycoordinatewildcardrandom-sampleinstallshufflehttprequestprogramming-pearlsformal-methodssdatastoreaudioqueuecustom-server-controlsasn.1http-status-codesnfawgetmalwarexbeeprocedural-generationjsonpextension-methodsleft-joinzookeeperbbcodedji-sdkonclickuser-generated-contentwritingcartrestful-urlinteraction-designrelevancesignaturefactdatabase-normalizationinternet-explorersencha-touch-2jslintqmakeapache-felixlanguage-implementationtexturesdata-partitioningavrontologypsr-2avl-treeobject-detectionmultiprocessorreadonlyweb.xmlehcacherx-scaladesignerconcatenationconvention-over-configurtetrisrtfmediafragment-shaderfixed-pointreferential-integrityworldwind32bit-64bitxsl-forootkitlogarithmpartial-classesdynamics-crm-2011quartz-2dsql-server-cestatic-librariescross-browserspring-integrationsmsmodel-bindingpoeaaapache-pigassignspring-data-jpabouncycastleenvironment-variablesavrcpmixed-modeperl-moduleargcapache2sanitizationpowerbuilderspecflowstarter-kitsdivide-and-conquerpython-requestsstruts2nullablejlabelphpspecresamplingtypescriptgasfrequencymacbookproliferayflat-fileadosocket.iojavascript-frameworkcommon-table-expressionsplpure-virtualwebpage-renderingradioxml-serializationprotectionhandlermono.cecilpalm-prepv3ddelaystatelesshateoastest-firstwindows-azure-storagejarvoid-pointerscustom-exceptionsmachcakephp-1.3design-guidelineswindows-xp-embeddedtransformerdigitformulaarrange-act-assertconditional-compilationphp-internalshqlsession-stateocslabelbittorrentlazy-loadingmulti-touchamazon-dynamodbtext-justifypurely-functionalandroid-servicebignumpollingsubscriptionextendscriptjscriptrpcaxiomamigadelphi-2009metasploitphonemazecloud-hostingcredit-cardopenearsquoteswatir-webdriverpreferencesmagentogoogle-closure-librarybackpropagationjni4netusb-drivevisitor-patternshardingevaldetectnurbsjavacvargument-passingshadrillthroughxna-4.0django-viewsc11spring-datadomdocumentobject-databasescsivtabletimingexpert-systemsystem-administrationedge-detectioncharcluster-computingtestabilityfunctional-dependenciesindesigndeviseinterface-designboost-mplmatrix-multiplicationclaims-based-identityaggregate-functionsrebuildsensorweightedevent-driven-designdeep-copyminifyy-combinatorregex-lookaroundsmulebidsstatic-constructorstreamingweb-frameworksvirtual-inheritancelarge-data-volumesbarcodeip-camerajtablecocos2d-xanonymous-functionglslesappendselfmeasuresmicroprocessorsperipheralshandlestmfinite-element-analysisapp-configpushhyperthreadingci-servercontinuationslong-integermarker-interfacesmultiprocessinginstrumentspapervision3dwxpythonclonejclweb-confightml-formcode-structureunits-of-measurementclass-table-inheritanceprimefacescoutoutput-bufferingminecraftxeon-phicrtpibatispivot-tableruby-on-rails-2symfony1leaky-abstractioncode-patchingapplication-designplayframework-2.0boilerplatedunituiscrollviewcursesdigital-signaturetfs2008githubswapgetjsoncontext-switchfluxmeteortemp-tablesmixed-modelsrepresentationsquarepyjamaselggparadigmsjdk1.5autosuggestpyopenclmaster-theorembreezesetup-deploymentasp.net-web-api-routingtransposejsp-tagsinoderttidjango-1.7traveling-salesmanunique-ptrknitrsplitsettimeoutplonesshobjectcontexttestngrexxcscrx-javantdllepollxamarinstrong-typingxamppdb2bankitunesreusabilityglossarycdcjrubydisassemblyllnugetbroadcastdecompositiongoogle-analyticsunsignednexttemplate-templatesmemoizationtimelineerror-reportingtexozcircular-dependencyvotiveparallel-extensionszipargument-dependent-lookuppower-managementnmakenoexceptteamcitywssassociativityforumsphinxgridviewendiannessadka2dphtml-agility-packcyphersingly-linked-listnumericin-app-purchasetable-drivendequestatic-memberscongestion-controlshared-objectsjavadocdraggableuartcollaborationsql-updateexc-bad-accessvoipsquare-rootsocialencogbasexvirtualembedded-resourcemessageboxlapplycircuitjstlcassandra-2.0pcrevisual-c++-2008-expresscstringactivemqstatakalman-filterwsgiintentional-programmingbllportabilityeffective-javamyisampinvokesurveyclockpie-chartios6externalsimpyreductioncocoa-design-patternsstring-algorithmibm-midrangeios7code-search-enginepdb-filesmanagerempty-listvaxrss-readertypo3monitorminixprototypingesb-toolkit-2.0gae-datastorewordpress-pluginnetbeans-7mesosmulticastwshrvalue-referencesummarydisjoint-setsthread-synchronizationintellij-ideaphotographytimezonelanguage-comparisonsip-addressiokitecmascript-6fuzzingcompiler-designgradientrevisionthread-local-storageweb-traffickendo-uiapplication-serverxcode7parent-childabstract-factoryxmlhttprequestdata-integrationturing-completeredirecttrackingoperator-keywordpolicyproduction-environmentpcdatabase-projecttypingabstractcontrol-flowaslrgyroscopecbc-macmicrophonecpu-usagerandom-accesslensesdecoderemote-controlhudsonconnection-poolingmaintaining-codeflowchartscadalync-2010spring.netreference-classfull-text-indexingjnienvstack-tracejoomla2.5error-recoveryportletaudioqueueservicesternary-operatorterracottagcc-warningmeshdisambiguationgcc6soa-suitesymbol-serverpdf-generationssas-2008midlproxy-patternhuffman-codingdiagramslaw-of-demeterquantum-computingownershiptabsdimensionms-access-2007adjacency-listapache-camelwsdlgacdocument-classificationpowermockitorigid-bodiesdatacontractsettingsmvccclosconfiguration-filesauditstdmapimage-segmentationmeasurementautoboxingpicbackwards-compatibilitybase-classsignedasp.net-web-api2network-scangoogle-spreadsheetmspeccase-sensitivetechnical-debtautofixtureaxis2helperangular-momentumtext-parsingmembership-providerselectorclrsservice-brokermwstitaniumremoteiomergewpf-controlsdalvikmethod-overloadingdjango-appscorsrpgledivisionmibcode-translationconcrete-syntax-treemultilingualobject-lifetimemonoidspayloadmathematical-notationdartphpdocvoice-recognitiongawkms-media-foundationlanguage68000glibcjathastochastic-process8086findthemespoint-of-saleendpointstessellationresponse.writemultitaskingguavadocbookmsbuild-propertygroupef-model-firstflex-mobilecomputational-financeseamcombinatoricsvectormathmoneymodelscode-cleanupjava-ioaddressingdjango-querysetxorgissequencenp-completediskurllib2mutual-exclusionlibgdxmedianvisual-studio-addinssamplingsleepminimaxdatabase-theorybuilder-patternoperationcomputer-science-theoryburndownchartsopenbdzigbeezopeembeddinginstallerkshgravityelasticsearchuserandroid-canvaspaintssmswcf-bindingextendpowershell-v2.0dicomgeolocationproduct-managementconfigurehdfsvideo-processingpremature-optimizationautoloaderscheduledexecutorservicelocal-variablesiqueryablecss-floatwix3.6gnuplotgraphicgoogle-chrome-osextractcommand-line-argumentsscreen-capturecodeccopy-protectiondurationlexical-closuresjava-ee-7preg-matchfedoraiifeblueprintlegacy-databaserdfapowerpcc64thread-priorityjgraphtwampprefixinteractionfortran77failoverexecutorgpioconceptinlineobject-modelrhinohtml-tablebeagleboarddata-transfer-objectsleadmultiple-dispatchfacebook-graph-apicrudwatirdmamappingradio-buttoncode-designinterface-builderloose-couplinggreedyshadowpyobjcsmpdatabase-migrationcomputer-forensicsvoronoilibjpegserial-communication32-bitmyfacesheap-memorywcf-clientsublimetexttlbjava-streamexponentiationservicemixmahoutdecoratornullpointerexceptionphp-5.3imagemagickoutlierspivotamazon-marketplacegit-mergeadd-inevent-simulationpaxoshigh-loaddrivesflash-builderstereo-3dmanaged-c++zend-viewpearcode-readabilityeraseflyweight-patternsuffix-treebeanshellofflinejavascript-objectsagentboxingmodern-languagestest-data3d-modelexportpublicassetsmojobackground-subtractiontrafficzenossshellsorttabletuitextfieldbranch-predictionfaceted-searchopencartreportviewerstandards-complianceisabellecustom-eventsbipartitedense-rankwizardsecure-sclevent-listenerslinkifyoauth-2.0unsupervised-learninginternet-explorer-10distractionsx++smackderivativeautomappingtruncater5rsstdthreaddocumentviewerdocument-managementbluezrust-dieselmacbooknhibernate.searchlockscgpdfdocumentproducer-consumermysql-workbenchcompiler-optionsexploratorydereferencefloating-accuracychromecastmicrocodinglabelsmsys2mouseovertwo-connection-limitweb-deployment-projectend-of-lifejsscproceduralwith-statementtabbaruser-managementsentiment-analysisjquery-selectorsmembusdotnetnuke-modulepsychoacousticsaero-glasshigh-trafficbackupfact-tablexamarin.androiduninstallbcintelrectleaderstringbuilderfakeiteasyjavacardplayframework-2.5vdspobject-initializersdynamics-ax-2009rcppdbix-classsunrpcneurosciencegtdmips32rating-systemsubroutineknockout.jsxenbuttonclickinfrastructureadomd.nethypervisoractionlistenermsdeployjasminequestion2answerdbicategoryjcespacenonlinear-functions.net-attributesnanivarcolor-managementsoap-clientroinotification-bardatatablecfcmultiple-monitorsjoysticklistingsjsf-2.2recordsetvb5class-instance-variablesuser-inputbabylonjsmfccscrumboardretrospectivesclass-methodenergyfacadestdoutelementadminfont-lock-modeglsurfaceviewcalculusinteger-overflowvoidexpansionuicollectionviewlayoutportraitdenotational-semanticsqdatetimeicommandmandrilllnflowdocumentgoogle-booksquerydslmac-classictuimanagedobjectcontextsapigeneric-functiondataformrspec-railsvalueupnpvs-unit-testing-frameworkspiswigaggregaterootcommit-messagepylintdigitaliphone-privateapiflash-cs5.5angularjs-factorycyrilliclibtoolsnmpdsequence-diagramviola-jonesexecutiveshole-punchingentity-framework-corestocksimplicit-typingrosmodbusgzipipv6crypto++aliascss-selectorsddd-servicevisualsvn-serverirqgoogle-pluspage-load-timectypeswininetevent-based-programmingservice-discoveryblendinggarnet-osinfraredcontinuousxml-parsingnsarraycontrollerinventionsotpdmpmexdsaoxygenegamepadcss-frameworksbezier-curvecappuccinomemory-segmentationinit-parametersfpsgnuradioeclipse-pdtopendireulaphasebuild-errortableviewbatch-processingcode-documentationdetectionunobtrusive-javascriptandroid-layout-weightcasablancacase-classhttp-status-code-403cloud9-ideceleryconfiguration-managementinternet-explorer-6google-searchanonymousunmanaged-memoryscala-collectionsdoxygennioandroid-bleparasoftautomated-deploybacklogname-lengthcp866betamasm32clssosexexpression-treesbinary-operatorsuser-agentprinter-control-languagedistributionillegalmonitorstateexcephaxeusage-statisticssbthttpclientaddressing-modeopcparallaxrendermemory-modelosgi-bundlesql-subselectpacmancoding-efficiencyheightmotorolaair-androidregister-allocationprofilesproj4jquery-ui-pluginsminimalmodbusbusiness-rulesaudio-convertercplexdjango-templatestimtowtdiscreen-orientationlegosolr-celldmdquantifiersfipstext-to-speechseasidemp4gnuradio-companionhelpermethodsrubocoptype-librarymodelbindersoverheatingderived-classglfwsmtppitch-trackingrmarkdowntree-balancingtexture2ddevtoolsopenjdkmagic-numbersndefruby-2.2polygononmouseoverendorsedmicrosoft-metrocurly-bracesgoogle-mapsdotnet-httpclientfetchasp.net-coreteradatalcseclipse-gmflimitsocial-graphbitconverterucabsplinespring-webflowdrupal-themingsieve-of-eratosthenesz3er-diagramsjboss6.xcomparatornapebacktrackingxml-rpcwidgetsunstudiolocaldbundoruntime-errorbufferinganchorgit-commitnsimageamortized-analysisjavasoundrichtexticuadldsdynamic-loadingdefault-valuecoldfusion-9tmparameter-passingnsblockoperationadaboosttest-planenterprise-architecttstringlisthpcdevice-contexturl-validationaffinetransformnet-snmpgladestringstreampassword-hashmemory-fencesrunspaceshfbms-dosobjdumpribbonbigtablebrownfieldcontourcallbynameprepared-statementjtextfieldassembly-signingadministrationgen-eventlogical-operatorstagfilelong-doubleequivalentinterface-implementationcentercursorgoogle-earthuipopovercontrollernstimeramqpmixture-modelkeyloggerbackground-imagetesting-strategiesvirtual-machinexamarin-studioinfopath2010calayercode-first-migrationsvolatilityjavafx-8wmlreturn-value-optimizationdotnetopenauthandroid-sqlitedropwizardtrunkcore-locationreflection.emitsqlclrsql-server-2014-expressasset-pipelineflatperspectivevisual-c++-2005contractsecurity-rolessanitizeunion-findstatechartstakerberoscollaborative-filteringcrosstabbubble-sortssjscustom-error-handlingintranetsolutionakka-clusterbazelnsaffinetransformbitcountbulk-loadbusyboxtradingsingularmarshallingkeep-alivexnanimationdouble-dispatchurlopenget-requestprincipal-componentshypothesis-testnotnulldirectshowkinect-interactionstdvectorxpslisp-2atomedit-distanceprogressivedeployment-descriptorodeintansi-92nsmenuitemserializablearray-initializationmustachedatabase-integrityruntime-compilationjquery-uiundefinednon-staticgattparametric-equationslsaroundhousestripestask-trackingalarmmanagerdefaulted-functionsalgebraic-data-typesmorfikhsmraw-socketsnetfiltericefacesassimpgreasemonkeyevented-iogenuinechannelsr-gridmultiple-tablesgoogletestdataflowsize-typemultimethodcapitalizationjmockitrubymotionxor-linkedlistcompass-geolocationssairepositoryqtquick2set-covermem.-efficient-linkedlistjtagoutputradrailssiebelmanagedsdpwavefrontdlnaubuntu-14.04mapperrootgroovyshellsequencescompass-sassienumeratorfunction-overloadingyoutube-data-apiobject-role-modelingwss-3.0s#arp-architectureaforgevariadic-functionslilypondnumber-theorysonarqubeactivitiactivity-monitorasp.net-mvc-areaslyncrelational-modelfactor-langlogic-programmingpickleprims-algorithmc++-ampjspincludepaddingmemory-corruptionopenpgphfilelisdocstringxcode5.1cjksliderplaybacksize-tconceptual-modelfeedsmtajoomla3.0ext3elastic-beanstalkcodigettextmove-semanticsmobile-applicationantlr4topologyuploadnull-object-patternactiveresourcekettleshopifyflood-fillface-detectionscreen-sizearbitrary-precisionfat32remote-accessintegralamazon-fire-tvbackground-processmefshoppinglibvlcaxsfinaeparallel.foreachstate-managementhttpwebrequestdependent-namejasper-reportsandroid-runonuithreadansi-sql-92j9chaosliterate-programmingcopy-assignmentwaitpidplacementvxworksheadaveragetensorflowhardware-accelerationuiview-hierarchycapistrano8051game-loophdcpogg-theorafeature-drivenwmfcodepagesarrowsha256script#kernel-modeproject-organizationcouchdbimage-zoomfinallypalm-pre2qt5backlightedidefaultmodelbinderacr122flushoutlook-vbaapache-portable-runtimephantomjsvirtual-pathcardinalityvisiondelphi-7pbxlibavirbx509certificatecshdockpanelyuvembedded-databasemotion-detectionss7openid-providernodesfitch-proofsopen-closed-principleui-helperoracle-ucmchange-data-captureskinningrmscairngormbinary-heapplyrfreeglutlines-of-codegoogle-style-guideoverridinghttpartyfseekpostswavdynamic-reportstranslatetomcat8roxygen2forgot-passwordschedulermixerieee-754netbsdexchange-servermsbuild-targetinstancesanonymous-inner-classvideo-editingoracle8iweldlandscapeswi-prologandroid-loadermanagerin-memory-databasefoafglibthreadgroupworkflow-enginelibc++linodemercurialdouble-checked-lockingautotoolscxfmaven-javadoc-plugincustom-eventsubjecticonshaskell-platformhardware-programmingexecutorservicetype-conversiontwiliowindows-identityentitiescache-controlsaxonout-of-memoryprintersdeclarativeintrusion-detectionwcf-restsilverstripecsrfdataframemultiple-indirectionrationalestreambufdatabase-firsttao-frameworkportfoliocqlcross-domaininstallshieldreallocpre-incrementlokiubercartbessel-functionsfile-conversioncomparablestarling-frameworkcyclicbarriernscoderdigital-logicturboc++agent-based-modelingoledbphotoshop-cs4lib-nfciphone-sdk-3.2svdnswindownegationfile-descriptormediacontrollermingw64cpythondatabase-tablehlslsassblockingqueueinterlockedchange-passworddecision-treepresentation-layerphpstormwapifftjson-apirefsaltcontainsstartupcadrecursive-datastructuresphylogenyupperboundgit-gcdata-entry.net-remotingjavafx-2sound-synthesisdesign-rationalegoogle-codegoogle-play-servicesgmailhoistingstm32texnic-centerosbmatlab-cvstoracle-coherencethread-localdata-profilingexecutable-jarsimultaneousrecurring-billingnumbafortran-iso-c-bindingsgigprsas-ifproject-layoutmechanizelocal-storageuigesturerecognizerguicewebdeployfeature-detectionminesweepersyntactic-sugarmanifestproviderwebservicehost3d-reconstructionmachine-translationsoftware-estimationtilesdatabase-managementjfacetaxonomyonline-repositoryhttpcontexttable-variableconverterinvalidatelua-tablec++buildercross-compilingtype-constraintszend-studiopopularityzshautolayoutdllimporthamlwebmatrixapplepayvisual-c++-2008triangulationnuget-packagecpanelfont-sizerefreshgraph-coloringgoogle-calendararm64sourcegear-vaultgetlatestyield-returncredit-card-track-dataexchangewebserviceslrusapfrontpagegroebner-basistreemapthread-specific-storagegoalironkey-value-codingvisualvmvisual-foxprojoomla1.6ibplugingtk3fast-espbox2d-iphonemotionnsoperationlcdspec#first-class-functionsfuzz-testingflexunit4virtualhostwpfdatagridswingbuildergit-tagcpfreebaseuiimageunmanagedanonymous-methodssitecoreoutlook-addinregression-testingwardenazure-documentdbfinal-classhard-codingapache-tikadvorakcppunitintegritysharepoint-2013companion-objectmac-app-storelotussupervised-learningconcrete-inheritancegetchmmapyahoo-financevmwaresliceapache2-modulemod-sslgridrisk-analysiszend-aclhammingweightwebsphere-mqlong-pollingcucumber-jvmhapijsreference-typeinjectsimplemembershiphectorprivilegesssrs-tablixrvaluenormal-distributionjxtavector-graphicscompound-operatorumbraco-blogclasscastexceptionasp.net-mvc-5invariantsmemory-poolstatsmodelsgenerativeasyncsocketregex-greedymsbuildcommunitytasksidentifiercrackinghash-collisiondelphi-prismdataproviderterminationmultiple-columnsrestifymonomacburnobservablecollectionscikit-imagecherry-picksniffingmethod-namesandenginev8compass-luceneimage-scannercdbdigestmutableweblogic11gsysvshorthandnstreecontrollerkarma-runnerrdbms-agnosticparameter-sniffinggnupgmysql-managementfindbugsmptttexture-mappingnhibernate-mappingmysqldumpu-bootcustom-buildmailslotacronymreorganizemahjongjboss7.xabstract-methodscounterbeautifiermessage-loopqgraphicssceneyoutube-apicoordinate-systemshttphandlertemplate-enginejdoautomatondelphi-5silverlight-5.0nice-languageportsgnome-3morphiafreertosredoquadtreegalaxyqgraphicsviewknuthhp-uxmayavigreatest-n-per-groupinclude-guardsactionresultencryption-asymmetricglewaccess-tokenstagingconcreteonpaintbrowser-cachetcshappframeworkniosfscanfoverlapped-ioeclipse-emftrampolinespersistence.xmlheader-onlyusb-mass-storageuitabbarcontrollernpscsftpl-dataflowpysideolexml-attributecopy-on-writeminimum-spanning-tree2-3-4-treeunpivotcodeplexswift2splinesql-deleteminimizelifecyclesrsfasmgriffonyqlvirtualboxoctreepredictprogram-flowshippingfilestreamimage-rotationgoogle-gdkchemistryipodssrs-2008appletpython-imaging-librarysafaridiscrete-spacecoldfusion-8recordsdrop-down-menuconcattemplate-haskellcalculated-columnsbeginreadxml-validationgrantclpqsymbolcircuit-diagramlightweight-processesidiomatic-perlimpersonationobject-initializationfeature-extractionmaven-3nested-loopsvisual-studio-expressclionexplorercheckboxcross-validationtyruscommentingusing-directivestouchscreentypesafe-activatorumbracox509certificate216-bitpygtkcomposite-keyexpression-evaluationcode-behinditerableadfslarge-filesaudio-recordingtr1qgraphicstextitemuieventelliptic-curveownerdistributed-cachingnsmanagedobjectrich-domain-modelcontravariancebigdecimalbare-metalcircuit-breakersysinternalsmockupssquishgrails-2.0parsekitfwriteaccessorybrute-forcemit-scratchnetbeans-platformaudit-trailpacket-snifferslate-bindinglistenermongodb-phpmsbixllpegormdatabase-tuningruby-on-rails-3.1spring-restcontrollerkerningwaveletbinary-compatibilityalertsgnatcgpdfscannerscalar-subqueryddlcellular-networkcan-busbit.lyfile-extensionevent-loopclass-hierarchymoosepreg-match-allflagsantivirusnoncopyablemedia-playeralloyrefcountingportalmatchingconst-correctnessandroid-studioinner-joinui-threadscheduleinterceptkiffluprgbecmamfiwhite-box-testingmodemdagger-2metapostdmlgpuimagecircular-referencestack-smashtransitivityremindersopenid-connectround-robinwtsap-connectorduplexocmocksystem-verilogentropystatusbaraccess-controltablelayoutalexa-skilldelegationgalaxy-tabtostringwxwidgetspos-taggingidempotentstabilitydata-cleansingasset-managementfile-permissionsrefactoring-databasesappkitcontext-specificationintellitracerpnscaleebnfdomxpathcommitmost-vexing-parseionictodosui-testingbindingsourcehexrolapfluorinefxbreakpointsoffice-2013color-spaceposix-apiradix-sortjlistargventry-pointweb-application-projecttext-filesdifferencepayment-processingskyfieldservice-layerlaunchobject-object-mappinghuman-readablejdbctemplatetypetraitsspray-jsonmozartfisheyecashomebrewcommerceuniquexslt-2.0windows-kerneloracleformspointer-conversionputcharjquery-globalizationedirectoryfiberrustpost-incrementkissfftbin-packingdelphi-xe2cortex-auinavigationcontrollernon-exhaustive-patternsdistortionequalizerline-intersectionslugspinlockslowdownscreen-brightnessvspackageerasureweb-config-transformmaybecode-migrationnsbitmapimagerepautomatic-ref-countingclass-variablespppuniqcygwinkinect.toolboxvirtuemartsimplyvbunitre-engineeringsudokulocaltimepharoiis-expressbeagleboneblackisbnteam-buildscrollinihidden-fileshungarian-notationstripe-paymentsimpactjsgnu-toolchainusability-testingoculusnsbuttoncellwebspherepowerpivotlibsvmevent-logpath-manipulationfirebugreferential-transparencytestdrivendesignpowersetdelimiterfunction-objectfirewalldelete-filejsdocvirtualallocdrmcycleidataerrorinfoblendthriftchecksumhadoop-partitioningrootviewcontrollershift-reduce-conflicthoverdomain-service-classintellij-13callocopenjpaoffice-2007scope-identityy86unionvrlibusbapi-keymicrosoft-fakesunreal-development-kitcard.iomemory-efficientosloxnuautomapperef-database-firstimage-enhancementdfsvpsmpegbitarrayxcode4.3avx512distinctcommodoredividestorage-class-specifiertrussstreet-addressprogram-structureselinuxjqtouchspatial-queryjustmocksingle-table-inheritanceparentopamnsbuttonjquery-ui-timepickerireportgwt2session-hijackingdefaultlistmodelrowremote-serverapplication-integrationinstance-variablesandroid-widgetvisual-studio-sdkdouble-clickkendo-mobilecompiledderivedalexa-skills-kitstructured-programminghttp-errormootoolsl-systemsbasicanalysis-patternsbapiios9.3gnu-smalltalksse2spring-data-neo4j3dsodatalmdirectx-10drawrectcomparison-operatorsjxcode7.3aixamazon-storedata-generationgoutteleiningenmisusent-native-apiqtcpsocketia64autoiphone-accessorysmartcardstorewhereinsertion-sortssdtboost-date-timemagnetic-cardswebrtcandroid-frameworktfs2013business-layerintermediate-languagespring-aopc#-6.0nomenclatureentity-modellgplsharedplyrgoogle-tvtimertaskclass-attributesphotogrammetrydcidata-drivenstanford-nlph.264ocpfilechoosersurfaceerror-correctionbitspymccapturexperfviterbivelocitygprofdatamartsemicolonpublishingboost-graphmouselistenertelerikshort-circuitingfeedbackios-ui-automationbinderlatencyopenjmsnumerical-recipesraspberry-pi3eclipse-emf-ecorejfilechooserquantifydarwinrdlcdecompressionmmunested-urlseigenup-castingwebosrequest-cancellingaccelerated-c++vc6lldbhill-climbingdifferentiationpostfix-notationngroute.bash-profileappstore-approvalwebdavcode-conventionsgraphics2dgraspuitypeeditorcompatibilityconstexprdeterministicconsistencycryengineemvandroid-2.2-froyoappdatajs-test-driverresultsetektroniframeforward-declarationpostscriptsoundcardpathgeometrypowershell-remotingpy2exehtml-selectlook-and-feellanguage-conceptsxsd-validationtransducernsstreampanlower-boundiec10967scapyclojure-core.logicmelregex-negationhibernate-mappingpartial-viewsselectlistgoogle-api-clientfile-organizationscrapersingle-page-applicationaccess-vbacrc-cardsjavacctweetsfoundationinteractivelogitechstatefulrowslinearizationstringbufferistringstreamthinitextostreamqueuingledpyserialreactive-programmingretainbitflagslpcpointer-arithmeticzombie-processconcurrenthashmapcreationzend-authdynamic-language-runtimeedit-and-continuecalculated-fieldevent-dispatch-threadqprocesstopic-mapsdaggeridentity-operatorsealedeachsim900haskell-modeelementsaspects3-tierandroid-syncadapterovertonehtml5-canvaspowershell-v3.0lookupdependency-managementpublic-keygunicornopennlpmozillarabbitmqctlmechanize-rubypgpjsonpathvisual-c++-2010erase-remove-idiomsonosexplicit-conversioneloquentopendatawebbrowser-controlscientific-softwareruby-1.8suitenescgaussianquery-performancedrawstringsession-timeoutapplication-structuregetcharjlsmosstomcat6bold-delphijscript.netisp-principleobjective-c++blockpysparklinecobol85usbserialsummarizationwebdriversqlalchemynumberpadslidemodularizationpreloadinginstruction-setopenalz80custom-attributesservice-referencemsp430ninject.web.mvcpenetration-testingshell-extensionsimage-capturesynchronizealignmentmatchretina-displaycore-textexecution-timezeromqwindow-functionssecond-level-cachestatic-filesjboss-portalexternal-accessorysystem-analysiscustom-membershipproviderwidthgnu-makeopenslbackbone-routingn-layerglobalsdynamic-assembliesnetbeans-6.9uibezierpathservlet-filterstandemqvtjavafx-12phase-commitimageiconnsubstitutedata-tracingsemantic-markupmatlab-coderrails-activerecordgraphical-logoplaying-cardsdrupal-themesisolationmolesadventureworkspypylinq-to-datasetblowfishrowlockingunity5wchar-tpositioningiis-8restkitasp.net-mvc-beta1naglegoogle-oauththread-sleepweb-deploymentvalgrindios9clauseios-universal-linkswcag2.0pyephemview-model-patternlinearsystem.arraypuppet-enterprisesupervisordodp.netwcagandroid-bluetoothgraphingqtablewidgetsessionidcgaffinetransformundo-redoasp.net-core-mvcexport-to-excelrspec2iptype-aheadvgathrowabletraining-datatreapsparqlyesodvisual-studio-debugginghttp-status-code-404in-placeservicehostdjango-celerybox2dnonlinear-optimizationnprreversionjetweblogic12cinformation-visualizationmoaiwindboolongdata-collectiontomeelamppython-db-apihindley-milnergruntjsgoogle-analytics-apipodnative-codebounding-volumepolicy-based-designskinavaudioplayersubmitperformance-estimationhttppostedfilebasenmapopentksparse-matrixencodespring-elandroid-sourceproxyplovrpyqt4facebook-chatreasoningbackbone-viewslogistic-regressionselflanguagecoverflowrational-unified-processhttp-requestmouseenterword-frequencygit-cherry-pickcapprolog-topleveldoctrinefolderscbperipheraldiagnosticside-customizationfixedpagepywin32java1.4url-shorteneruiimagepickercontrollerhotswaptimespanhpricotsharepoint-apionclicklistenerunresolved-externaloculus-runtimestrictxorgmidjeemail-spaminvokelaterpentahoudevalphablendingupgradewebshopado.net-entity-data-modelsqlyogdynamic-castimmutable.jsresource-contractsproject-templatezippersystem.diagnosticsboidsvisual-studio-templatessniffercontrol-charactersegovernmentxml-signatureloadlibrarystochastictrieeasymockvariable-lengthapriorifogbugzquotationsfusetwos-complementshelvingsinglepageweb-site-projectcorbanlmelight-injectfaultwsclossless-compressiongamingxdt-transformformatsalesforceidispatchwcf-ria-servicesmemory-mapped-filesthreadxintel-edisonaccountmanagerc++03activex-documentsdefault-constructortargetbreadth-first-searchswcexittelephonytbbspritelowpass-filtersconsxaequality-operatornon-typememory-editingwinrt-xamllrculturetransactionaljob-schedulingfilesystemobjecthtml5-kickstartwireframesamlcontrol-structurequery-tuningapplication-layerw3cparticleintel-micpngraycastingcombinatorsemtransaction-loghtml-content-extractionperiodprivate-keysigilskolmogorov-smirnovcontext-boundx11documentation-generationdeclarative-programmingncursesunordered-mapbarcode-printingvalidationattributemod-perljavassistcaliburn.micromscapihttp-headerspyopenglazure-storage-blobswindows-embeddedcommercial-applicationcharacteristicsactionsimulinkgranularitycryptoapiprotocol-buffersocunitgreen-threadswindows-integrated-authpidscalatestprogressdialogscenariosdbunitpowershell-v4.0stubsedifacttypographycore-imagentpindexofasterisktfs2012resource-managementdata-consistencywinddknpmcoldboxhtml-listsilasmuicollectionviewnopcarouselcs50rdocsrandcross-correlationwindows-explorerfrebinstagram-apipostordervisualdesignerlexical-castmenuitemdynamic-arraysjava-ee-5dynamics-crm-4tildefile-sharingdjango-urlsoverusestored-functionsoptionscreateobjectbibtexrubymineironpythonqtableviewreducingnsdatamod-rewriteisoblobchomsky-normal-formwin32guitightly-coupled-codecomment-conventionsdocument-databaseoverwriteandroid-sensorsdespass-by-rvalue-referencelspictureboxcontractsactivesupport-concernuibuttonmethod-signatureinterpretationasp.net-controlsspell-checkingobject-oriented-perlstring-substitutionpowerbuilder-pfcwindows-95servercontrolspitchzseriestransitionsglkithornetqtype-providerspostsharpiommussdamazon-snsplaneweb-controlsautomatic-propertiesbrokertre-libraryspellingpygleteasyphpqthreadapproximationjcanvasstring-lengthhrefweb-farmmapkitmsysgithp-nonstopcontroltemplateslatitude-longitudesimplifyvoxeltesseractmulti-table-inheritanceproperties-fileioexceptionevent-storeobject-createclearcaseidocscriptmethod-chainingextreme-feedback-deviceshamcrestmongodb-queryida-prosurfaceviewdjango-ormprivate-constructorpromptvmallocumtsalunstimeintervaladtinter-process-communicatwifstreamhsqldbpcmdocumentdatabase-restoreviewresultspecializationdepth-first-searchestimotesuppress-warningswin64god-objectfaceboxavassetreaderhttpresponsemnesiaopenmpipetapocominikanrengeographical-informationvipsgotchasmongodb-csharpbundleexcel-formulamissing-datapageloadstrict-weak-orderingmapping-modelexcel-2007navigation-drawerkextrender-to-textureclojurescriptmodula-2directed-graphangularjs-serviceattsilverlight-3.0dftdemoservice-locatorcorrectnessperl-data-structuresboolean-expressionnuget-serverdecodinggsoapcase-insensitivenxtrfidlightingflowlayoutpaneldjango-admincircular-bufferunrealscriptjgroupsaudio-processinghiveabapvncside-effectsprofilerknnstatic-typingprotected-modefirst-order-logiccode-by-voiceansi-cdirectoryservicesinterpretedlocklessnsimageviewuicomponentsws-federationusernameowinurl-patternwmi-queryqsortcls-compliantaccelerate-frameworkformatted-inputsafety-criticalargument-deductionstring-comparisonservlet-containerexpectalterjxlheap-randomizationuseridextjs4shtmlrow-numberrelative-pathviewmodeloccasionallyconnectedpowermockfacebookeraudio-streamingpage-lifecycledeferredberkeley-dbnamed-entity-extractiondoubly-linked-listvertex-shaderfacetd2rails-routingrtpshortcutexpression-templatesindustrialwhmdaxbpmnstringtokenizerspreadsheetinitial-contextbuild-scriptscalaralexa-voice-servicepipelineray-pickinglinesazure-active-directoryimageviewresponsesetjmppolyhedraunificationmessagesarduino-idelagsqueakintervalssetfocusorchestrationnao-robotandroid-permissionsthrowjbpmtimeoutexceptionyarndeep-linkingone-to-manypipeliningidocrelative-addressingwildflystaruml.net-corepalindromeandroid-uixulrunnerduck-typingamazon-elbpingreverseperspectivecamerasql-server-2008-expresspixelmetatrader4variable-typesfoxproswingworkerxtsjekyllshared-nothingactionscript-2apkeaaccessoryhtml5boilerplatestatic-factorymmslibxml2swizzlingapache-spark-sqlpolynomial-mathphobosucmafgetccbirheightmapjoptionpanesublistflash-messagevlcaccessorsavonriscwebhttpyui3xjcdatabase-administrationfinite-state-machineopc-uamember-pointersmindstormsspring-profilesstructuremapprettyfacesdna-sequencecondition-variablejndiwcf-hostingbracespresentationcatalystjquery-tooltipobjective-c-categorynsisaplcreate-tableseriesnswindowcontrollerdatabase-replicationdecrementmathematical-expressionsviewbagitemgroupjboss-mdbdecltypesequentialfaceletsrepeatsdl-2real-modedo-whileext4sitedesignprolog-difc-librariesiis-6context-sensitive-grammarflowthe-little-schemershiftia-32sybaseseeklog4jqt-designerreactiveuisftpnsregularexpressiondbcontextadjacency-matrixtracingbuild-systemcartesianchannellinux-distrosehc++-conceptsroslynhadoop-streamingrgsdirent.hvsewsspartial-specializationamazon-s3netshpatchboost-asiolow-memoryserialversionuidrs485visual-web-developerinputstreamvisual-studio-2003image-conversiondelphi-6dotnetnuke-imcmit-schemeentitymanagersignalrunique-constraintlocalstokenizeplpythonchunkingboost-anycpu-speedpage-tablesfilteringinformation-hidingshapefileyasmfractionscpancasevirtual-destructorobject-pascalsql-server-2014event-based-componentseclipse-gefverificationdepth-buffertext-extractionrelaycommandorientdbembedded-languagenotifyhypertalkpci-emarklogiccartographyaddsubviewjbuttonsuspendmach-o.net-micro-frameworkcatalogsts-springsourcetoolsuitemasterstellentcss-specificitylevelsconnectionssandcastleurllibldpresenterchicagobossprototype-programmingduplicate-removalcmake-guitype-systemsdocument-readyuuidconnectrecurrencesublimetext2firebirdjquery-effectsappiumoauthis-emptyfind-by-sqlhypermedia3d-modellingusergroupsvnc-serverroguelikesuperclassinsightbusdynamic-scopefunction-templatesandroid-mapviewbytebufferfunction-pointsrights-managemententity-framework-4.3identity-mapspatial-indexfibonacci-heapstatementswhite-boxopencmsdatabase-agnosticnetmodulessparcdecompilerarmcccakephp-2.0azure-web-rolespikecross-productlotus-notesnspredicaterobotandroid-navigationviewps3securityexceptionappdomainblendersql-scriptsdemoscenefancyboxextendspiautomated-deploymentnoscriptdxgitouch-typingjava.util.scannerpython-3.3django-staticfilesgenerative-artpci-dsscancurryingnonetypesql-execution-plantaggingambaatomicitymotion-planningaccurev6510adhoc-queriesmongodb-rubycircular-listsystem-requirementsforumshidden-fieldframehttp-getwavec++98cap-theorembiological-neural-networkautoclassoracle9iclass-visibilityfile-readfluidurwidzend-formhostnamewindows-shellresolutionandroid-dialogreducersitanium