We analysed more than 40 000 000 questions and answers on stackoverflow.com to bring you the top of most mentioned books (5720 in total)

How we did it:

  • We got database dump of all user-contributed content on the Stack Exchange network (can be downloaded here)
  • Extracted questions and answers made on stackoverflow
  • Found all amazon.com links and counted it
  • Created tag-based search for your convenience
  • Brought it to you

For any feedback, any questions, any notes or just for chat - feel free to follow us on social networks

Recomended tags

Top templates books mentioned on stackoverflow.com

Design Patterns

Ralph Johnson, Erich Gamma, John Vlissides, Richard Helm

Capturing a wealth of experience about the design of object-oriented software, four top-notch designers present a catalog of simple and succinct solutions to commonly occurring design problems. Previously undocumented, these 23 patterns allow designers to create more flexible, elegant, and ultimately reusable designs without having to rediscover the design solutions themselves. The authors begin by describing what patterns are and how they can help you design object-oriented software. They then go on to systematically name, explain, evaluate, and catalog recurring designs in object-oriented systems. With Design Patterns as your guide, you will learn how these important patterns fit into the software development process, and how you can leverage them to solve your own design problems most efficiently. Each pattern describes the circumstances in which it is applicable, when it can be applied in view of other design constraints, and the consequences and trade-offs of using the pattern within a larger design. All patterns are compiled from real systems and are based on real-world examples. Each pattern also includes code that demonstrates how it may be implemented in object-oriented programming languages like C++ or Smalltalk. 0201633612B07092001

More on Amazon.com

Domain-driven Design

Eric Evans

Describes ways to incorporate domain modeling into software development.

More on Amazon.com

Patterns of Enterprise Application Architecture

Martin Fowler

This volume is a handbook for enterprise system developers, guiding them through the intricacies and lessons learned in enterprise application development. It provides proven solutions to the everyday problems facing information systems developers.

More on Amazon.com

Refactoring

Martin Fowler, Kent Beck

Users can dramatically improve the design, performance, and manageability of object-oriented code without altering its interfaces or behavior. "Refactoring" shows users exactly how to spot the best opportunities for refactoring and exactly how to do it, step by step.

More on Amazon.com

The C Programming Language

Brian W. Kernighan, Dennis M. Ritchie

Introduces the features of the C programming language, discusses data types, variables, operators, control flow, functions, pointers, arrays, and structures, and looks at the UNIX system interface

More on Amazon.com

Modern C++ Design

Andrei Alexandrescu

This title documents a convergence of programming techniques - generic programming, template metaprogramming, object-oriented programming and design patterns. It describes the C++ techniques used in generic programming and implements a number of industrial strength components.

More on Amazon.com

Effective STL

Scott Meyers

"This is Effective C++ volume three - it's really that good." - Herb Sutter, independent consultant and secretary of the ISO/ANSI C++ standards committee "There are very few books which all C++ programmers must have. Add Effective STL to that list." - Thomas Becker, Senior Software Engineer, Zephyr Associates, Inc., and columnist, C/C++ Users Journal C++'s Standard Template Library is revolutionary, but learning to use it well has always been a challenge. Until now. In this book, best-selling author Scott Meyers ( Effective C++ , and More Effective C++ ) reveals the critical rules of thumb employed by the experts - the things they almost always do or almost always avoid doing - to get the most out of the library. Other books describe what's in the STL. Effective STL shows you how to use it. Each of the book's 50 guidelines is backed by Meyers' legendary analysis and incisive examples, so you'll learn not only what to do, but also when to do it - and why. Highlights of Effective STL include: Advice on choosing among standard STL containers (like vector and list), nonstandard STL containers (like hash_set and hash_map), and non-STL containers (like bitset). Techniques to maximize the efficiency of the STL and the programs that use it. Insights into the behavior of iterators, function objects, and allocators, including things you should not do. Guidance for the proper use of algorithms and member functions whose names are the same (e.g., find), but whose actions differ in subtle (but important) ways. Discussions of potential portability problems, including straightforward ways to avoid them. Like Meyers' previous books, Effective STL is filled with proven wisdom that comes only from experience. Its clear, concise, penetrating style makes it an essential resource for every STL programmer.

More on Amazon.com

C++ Templates

David Vandevoorde, Nicolai M. Josuttis

With the greatly increased use of templates, there is a real need in the C++ community for this information. This book is the next C++ classic, acting as both a complete reference as well as a tutorial. It emphasizes the practical use of templates, and includes real-world examples.

More on Amazon.com

Architecting Microsoft .NET Solutions for the Enterprise

Dino Esposito, Andrea Saltarello

Provides information on designing and building effective enterprise solutions, covering such topics as UML, the business layer, the service layer, and the data access layer.

More on Amazon.com

Compilers

Alfred V. Aho, Ravi Sethi

This book provides the foundation for understanding the theory and pracitce of compilers. Revised and updated, it reflects the current state of compilation. Every chapter has been completely revised to reflect developments in software engineering, programming languages, and computer architecture that have occurred since 1986, when the last edition published.& The authors, recognizing that few readers will ever go on to construct a compiler, retain their focus on the broader set of problems faced in software design and software development. Computer scientists, developers, & and aspiring students that want to learn how to build, maintain, and execute a compiler for a major programming language.

More on Amazon.com

The C++ Standard Library

Nicolai M. Josuttis

Contains full coverage of the ANSI/ISO C++ standard. The text covers classes, methods, interfaces and objects that make up the standard C++ libraries.

More on Amazon.com

Thinking in Java

Bruce Eckel

Bruce Eckel's Classic, award-winning Thinking in Java, Fourth Edition - now fully updated and revised for J2SE 5.0!

More on Amazon.com

Great Lakes, Great Stakes

Institute for Conservation Leadership, Environmental Support Center, Great Lakes Environmental Community Project

More on Amazon.com

C++ Template Metaprogramming

David Abrahams, Aleksey Gurtovoy

At long last, this much-awaited book delivers practical metaprogramming into the hands of the everyday C++ programmer.

More on Amazon.com

Programming

Bjarne Stroustrup

The inventor of C++ gives perhaps the most important introduction to programming ever written.

More on Amazon.com

PHP 5 Objects, Patterns, and Practice

Matt Zandstra

PHP 5's object-oriented enhancements are among the most significant improvements in the 10+ year history of the language. This book introduces you to those features and the many opportunities they provide, as well as a number of tools that will help you maximize development efforts. The book begins with a broad overview of PHP 5's object-oriented features, introducing key topics like class declaration, object instantiation, inheritance, and method and property encapsulation. You’ll also learn about advanced topics including static methods and properties, abstract classes, interfaces, exception handling, object cloning, and more. You’ll also benefit from an extensive discussion regarding object-oriented design best practices. The next part of the book is devoted to a topic that is often a natural extension of any object-oriented introduction: design patterns. PHP 5 is particularly well-suited to the deployment of these solutions for commonly occurring programming problems. The author will introduce pattern concepts and show you how to implement several key patterns in your PHP applications. The last segment introduces a number of great utilities that help you document, manage, test, and build your PHP applications, including Phing, PHPUnit2, phpDocumentor, PEAR, and CVS.

More on Amazon.com

Effective Modern C++

Scott Meyers

Presents a collection of tips for programmers on how to use the features of C++11 and C++14 effectively, covering such topics as functions, rvalue references, and lambda expressions.

More on Amazon.com

Algorithms on Strings, Trees and Sequences

Dan Gusfield

String algorithms are a traditional area of study in computer science. In recent years their importance has grown dramatically with the huge increase of electronically stored text and of molecular sequence data (DNA or protein sequences) produced by various genome projects. This 1997 book is a general text on computer algorithms for string processing. In addition to pure computer science, the book contains extensive discussions on biological problems that are cast as string problems, and on methods developed to solve them. It emphasises the fundamental ideas and techniques central to today's applications. New approaches to this complex material simplify methods that up to now have been for the specialist alone. With over 400 exercises to reinforce the material and develop additional topics, the book is suitable as a text for graduate or advanced undergraduate students in computer science, computational biology, or bio-informatics. Its discussion of current algorithms and techniques also makes it a reference for professionals.

More on Amazon.com

The Java TM Programming Language

Ken Arnold, James Gosling, David Holmes

This definitive introduction and reference teaches programmers the basic and advanced features of Java. As the creators of the Java programming language, the authors help programmers understand why Java is such a powerful language.

More on Amazon.com

DEVELOPING ASP NET SERVER CONT ROLS

Nikhil Kothari, Vandana Datye

Web Forms—the Page and Control Framework at the heart of ASP.NET—makes it easier to develop dynamic Web applications. But you can go beyond the controls that ship with ASP.NET—and power up your Web sites and applications—by creating your own server controls. You can also develop and distribute your own controls for commercial use. This comprehensive guide, direct from key insiders who really know the technology, combines conceptual and architectural details with practical, how-to information and real-world code samples to show exactly how to create custom, reusable, professional-quality server controls with rich design-time functionality. It also provides essential information about configuration and the HTTP runtime, packaging, deployment, debugging, and developing controls that incorporate XML Web services, plus other vital topics. And it introduces the ASP.NET Web Matrix tool for creating Web applications and for using server controls. Topics covered include: OVERVIEW ASP.NET page programming Component programming SERVER CONTROLS User controls Implementing properties View state management Rendering Control life cycle Events and Postback Styles Composite, validator, and data-bound controls Client-side behavior Design-time functionality Localization, licensing, and deployment SERVER COMPONENTS XML Web services HTTP handlers SERVER CONTROL CASE STUDIES Templated data-bound controls DHTML-based server controls “[This book] is a must-have for all serious ASP.NET component developers.” –Scott Guthrie, Product Unit Manager, Microsoft ASP.NET Product Team

More on Amazon.com

A Retargetable C Compiler

Christopher W. Fraser

Examining the implementation of lcc, a production-quality, research-oriented retargetable compiler, designed at AT&T Bell Laboratories for the ANSI C programming language, this book is designed for professionals who seek a detailed examination of a real-world compiler. A thorough and accurate picture of the lcc compiler is provided, and a line-by-line explanation of the code demonstrates how the compiler is built. The accompanying disk holds the full source code for the lcc compiler, the three back ends and the code-generator.

More on Amazon.com

C++ common knowledge

Stephen C. Dewhurst

Distils, in one slim volume, what every intermediate-level C++ programmer needs to know in order to do professional, quality work.

More on Amazon.com

The Non-designer's Design Book

Robin Williams

Defines page layout and design principles and explains how to use space, color, and type to create dynamic-looking documents and Web pages

More on Amazon.com

Imperfect C++

Matthew Wilson

Imperfect C++ C++, although a marvelous language, isn't perfect. Matthew Wilson has been working with it for over a decade, and during that time he has found inherent limitations that require skillful workarounds. In this book, he doesn't just tell you what's wrong with C++, but offers practical techniques and tools for writing code that's more robust, flexible, efficient, and maintainable. He shows you how to tame C++'s complexity, cut through its vast array of paradigms, take back control over your code--and get far better results. If you're a long-time C++ developer, this book will help you see your programming challenges in new ways--and illuminate powerful techniques you may never have tried. If you're newer to C++, you'll learn principles that will make you more effective in all of your projects. Along the way, you'll learn how to: Overcome deficiencies in C++'s type system Enforce software design through constraints, contracts, and assertions Handle behavior ignored by the standard-- including issues related to dynamic libraries, static objects, and threading Achieve binary compatibility between dynamically loading components Understand the costs and disadvantages of implicit conversions--and the alternatives Increase compatibility with diverse compilers, libraries, and operating environments Help your compiler detect more errors and work more effectively Understand the aspects of style that impact reliability Apply the Resource Acquisition Is Initialization mechanism to a wide variety of problem domains Manage the sometimes arcane relationship between arrays and pointers Use template programming to improve flexibility and robustness Extend C++: including fast string concatenation, a true NULL-pointer, flexible memory buffers, Properties, multidimensional arrays, and Ranges The CD-ROM contains a valuable variety of C++ compilers, libraries, test programs, tools, and utilities, as well as the author's related journal articles. New and updated imperfections, along with software libraries and example code are available online at http: //imperfectcplusplus.com. (c) Copyright Pearson Education. All rights reserved.

More on Amazon.com

Advanced C++ Metaprogramming

Davide Di Gennaro

The book tries to be both an introduction and a reference to C++ template metaprogramming; TMP is presented in the book as a set of techniques that will bring a new style in C++ and make code exceptionally clear and efficient. The book deals with language aspects, design patterns, examples and applications (seen as case studies). Special emphasis is put on small reusable techniques that will improve the quality of daily work. Visit http: //acppmp.blogspot.com/ for book errata and updates

More on Amazon.com

The boost graph library

Jeremy Siek, Lie-Quan Lee, Andrew Lumsdaine

CD-ROM contains: Source code of BGL -- Fully searchable hyperlinked version of text.

More on Amazon.com

Design Patterns for Object-oriented Software Development

Wolfgang Pree

Software -- Software Engineering.

More on Amazon.com

Computational Geometry and Computer Graphics in C++

Michael Jay Laszlo

This book provides an accessible introduction to methods in computational geometry and computer graphics. It emphasizes the efficient object-oriented implemenation of geometric methods with useable C++ code for all methods discussed.

More on Amazon.com

javac#c++c.netalgorithmphppythonjavascriptdesignasp.netlanguage-agnosticdesign-patternsandroidoopsqllinuxdatabasematharchitectureperformanceprogramming-languagesresourcesuser-interfacemysqlhtmlsql-serverwindowsiphonerubyiosmultithreadingdata-structuresresearchobjective-csecuritycomputer-scienceassemblyruby-on-railsjquerydatabase-designdocumentationasp.net-mvcunit-testingrcompiler-constructiontestingunixcsssoftware-engineeringwpfartificial-intelligenceweb-applicationsvb.netreferenceclassvisual-studioweb-servicesoptimizationarraysnetworkingproject-managementjava-eeumleclipseosxcoding-styleagilegraphicswinformsoperating-systemmemory-managementoracleembeddedspringwinapivisual-c++image-processingmodel-view-controllerajaxhardwareparsingfunctional-programmingregexamazonmemorytddtheoryinheritancefunction3dstatisticsperlopenglkernelopen-sourcexcodeapistringnlpxmlcocoawcfentity-frameworkdebuggingmachine-learninginterfacerefactoringactionscript-3concurrencymatlabrestdomain-driven-designdelphic#-4.0stlgraphpointersnode.jsscriptingopengl-estemplatessharepointidelispsilverlightdjangoprocessparallel-processingamazon-web-servicesuntaggedcommand-linex86scalasocketssql-server-2008visual-studio-2008frameworkshtml5audioobjectlistneural-networkproject-planningvb6visual-studio-2010flexswinglinux-kernelstandardslogicproductivitysearchencryptionc++11mobilec++-faqqtscrumgccscalabilityf#genericsmfcflashhaskelltsqlsortingsoftware-designversion-controllinqsql-server-2005treeweb-scrapingterminologyimagemethodologyasynchronousvbaxamlvariablesshellasp.net-mvc-3boostexcelooadopencvusbcryptographyc#-3.0eventsphysicstypesapachepluginsnetwork-programminghibernatetcpclojurematrixsyntaxmethodsssasrecursionsignal-processinggeometrycachingfortranpostgresqlcocoa-touchdependency-injectionschemestackipadgame-enginefileclass-designauthenticationinterpreterdeploymentarduinomodelruby-on-rails-32djsondirectxbluetoothfrontendusabilityspring-mvccomputer-visionformslambdasoawebinternalscollectionslinux-device-driverfilesystemsejbexceptionnhibernatevectorqadllcomlanguage-design.net-3.5linq-to-sqlvideogarbage-collectionhttpembedded-linuxjvmsqlitenaming-conventionssystembashimplementationmvvmtimezend-frameworkwebsitebddjspdata-access-layerthread-safetyscientific-computingvalidationindexingjunitosdevmockingopensslconstructorgrailsuser-experiencexpathreal-timerelational-databasecompilationmodelingtextmongodbdata-modelingormextreme-programmingprotocolsdevelopment-environmentprojectwebformsanalysisposixlow-levelclient-serversingletonservletsdata-miningsynchronizationclrcomparisonlanguage-featuresamazon-product-apimonocommon-lispmicrocontrollercontinuous-integrationhadoopxnacomplexity-theoryasp.net-mvc-4diagramcudasimulationencapsulationrandomhyperlinkdommacrosmusicshaderprojectsgwtjoinms-accesse-commercelinked-listwindows-phone-7linkerbinarydictionarystaticanti-patternscontent-management-systempolymorphismloopsstructurevisualizationstructactionscriptjpasvndata-warehouseabstract-classgroovyclosurescss3distributedprologtfsexception-handlinganimationdynamic-programmingdiscrete-mathematicssocial-networkingiorepository-patternif-statementcpuhashautomated-testssslkeyboardcode-reviewdynamicmetaprogrammingseleniumeclipse-pluginestimationheapgenetic-algorithmcode-generationlockingclassificationolapdrupalroboticsreverse-engineeringspecificationscomputational-geometryazurenormalizationmemory-leaksdriverssisopenclprofilingopengl-es-2.0grammarraspberry-picastingjava-meelectronicsmsbuildpthreadsarmxhtmlscreen-scrapingpropertiescanvastomcatuser-interactionrenderingpython-3.xstored-proceduresinputnullandroid-ndknosql.net-4.0scopeplsqlhistorydevice-drivervhdlios5pattern-matchingmessagingrequirementscommentscpu-architectureubuntujsfcommunicationasp.net-ajaxnunitipcinversion-of-controldesign-principlesclouderlangdefinitionworkflown-tierxsltnamespacesmoduleblogssolid-principlessharepoint-2010gitgpudelegatesextjsdatasetlayoutsoaphigh-availabilityfftmakefileintegration-testingparameterscomputer-architecturenetbeansswiftruntimereporting-servicesquery-optimizationlegacygoogle-app-engineios4windows-7pocograph-theorydsltransactionsasp-classicautomationconfigurationsharepoint-2007workflow-foundationuse-caseinitializationfacebookreflectionbuttoniteratorado.netbig-odata-visualizationtimerbuildfull-text-searchactiverecordoperator-overloadingandroid-layoutcallbackjnibit-manipulationsymbianturing-machinesx86-64csvangularjsmigrationsdkconventionsexcel-vbajavafxtext-miningserializationerror-handlingbusiness-intelligenceannotationsbiztalkaopssl-certificatecucumberappleidiomaticmutexocamlcoldfusionrotationfinancebuild-processcore-dataincludedesktopfor-loopformal-verificationkinectbluetooth-lowenergyvimmapgpgpuwindbgasp.net-2.0constants.net-2.0global-variablesmultiple-inheritanceiisdownloadsrpentityreportingeditorknapsack-problemprocessordatetimemavenjbossswitch-statementcode-organizationchartsmallocbisonpkiimmutabilityloggingsoftware-qualityenumsmipsfirmwarecode-coverageserial-portseparation-of-concernscodeigniteralgebraintegrationc++-clischedulingmetricsoperatorsglassfishrspeccompressionxcode4procedural-programmingpdfcameraosgientity-framework-4.1printfcode-metricsyacclicensingfinite-automatafile-ioserviceopengl-3mdxhtml-parsingload-balancingtime-complexitycross-platformurlsignalspersistencelexwindows-8verilogunicodereadabilityportingnew-operatorwolfram-mathematicagame-physicsmapreducemulticorewhile-loopc#-2.0vm-implementationcakephprsavisual-studio-2005nestedc99colorsgdbbinary-treenamingbuild-automationcocos2d-iphonepython-2.7asp.net-mvc-2floating-pointoverloadinginternationalizationcilinformation-extractioncompiler-theorybrowserpowershellconstforeign-keysjsf-2time-managementmessage-queuehciblackberrynetwork-protocolsglslencodingsaasopengl-4uitableviewudpilgembsdmultidimensional-arraystatic-methodswebglidiomscertificateaesioc-containerrtoslocalizationadaptercurlbeautifulsoupintegermanualtask-parallel-librarystreamclient-sidelatextaskswtautomataphpunitmoqatomicejb-3.0expression-blenddnsclientawtreviewsql-server-2012terminalpseudocodelinear-algebrapass-by-referencecontact-formcqrsweb-crawlercode-smellstrategy-patternexpressstatedriverspublic-key-encryptionvisual-studio-2013prototypeevolutionary-algorithmbackbone.jsspeech-recognitiondrawingosx-snow-leoparduser-controlssemantic-webselectentity-framework-4booleanpermissionsbioinformaticspsychologyvisual-studio-2012heuristicsrdbmslucenesteganographyjsoupaugmented-realityinterruptpair-programmingcallscrapecompact-frameworkbindingtime-seriesinteropdata-accessglutraytracingdependenciesfactorydevicewarningstemporal-databaseseoreturn-valuedevelopment-processnumbersfactory-patterndistributed-computingsmltransitionjdbcjerseytext-editorlaravelbusiness-logicsessionpattern-recognitionfiltersystem-callscontrollerthreadpooloutlooksql-server-2000jitsetasp.net-web-apiwordpresscdimemcachedbytecodestate-machinesbitmapunity3dmathematical-optimizationrmibrancharraylistopenmpcomponentsconditionalsicpluagame-theorythisocrbiztalk-2010jquery-mobileevent-handlingactivexsyncarchitectural-patternsxsdsynthesispathatlnumerical64bitcode-snippetsassertbinary-search-treeinsertrazorsasjoomlanfcinternalxunitcoordinatesemacsui-designcompiler-errorssamplevirusdatamodelteamworksystems-programmingjiracontext-free-grammarawkstdschemadatehttpssolrgraphic-designandroid-activityvirtual-memoryauthorizationgrepsmart-pointersesbcopybatch-fileiterationvirtual-functionsasync-awaitninjectconditional-statementscgiprimitivefunctorrelease-managementrequestapi-designstatic-analysisassertionsphotoshopstylesorderdatabase-schemaactordiscoveryabstractionwindows-cebuffereclipse-rcpmvpbuffer-overflowantoracle11gdatabase-connection.net-3.0windows-mobileclass-diagramtraitsrssquartz-graphicscvsshopping-cartbigdatamvvm-lightfpgaroutingef-code-firstphysics-enginegdicobolprobabilitytelecommunicationsegmentation-faultsharepoint-brandingtimeoutwebsocketsemaphoredaemonjava-ee-6akkacrashhashmapmysqliobserver-patterndsl-toolscapacity-planningdesktop-applicationwindows-xpiis-7batterysql-server-2008-r2attributesmetadatacluster-analysisevent-drivencompile-timedifferential-equationssql-injectionprojects-and-solutionsexploitversioningdaohashtablegnuobject-oriented-analysisload-testinglambda-calculusidisposablerdfmongrelcollision-detectionportsymfony2consolefault-toleranceggplot2jpegc++14performancepointviewcompiler-developmentgraph-algorithmyiiregressionargumentstfs2010qt4loginwtlpublish-subscribemodularityimportmontecarlomousequeuekernel-modulesearch-enginelock-freecode-analysisreference-manualprotectedcustom-controlsinstanceguidcontrolsrepositorycompiler-optimizationrestful-architecturecsprojstrutsmonodevelopcalculatormiddlewarefuzzy-logicdojodatabase-performancerunnabledrupal-7business-logic-layercode-contractsprintingxamarin.iosxpagesnativeshared-memorysharepoint-designerautomated-refactoringmudtry-catchwcf-data-servicesequationpygamekr-cbinary-searcht4smalltalkrelationalwirelesss4race-conditionpackage-designbenchmarkingcharacter-encodingheader-filesasp.net-mvc-routingdatamapperinline-assemblydoubleheaderlanguage-theorylabviewanalyticsdata-analysisvisual-sourcesafemarkovtranslationtypedefstack-overflowcore-animationjmsdirectoryundefined-behaviorvalue-typesynchronizedlucene.netlegacy-codecpu-registersfsmmpifunctional-testingarticlelibrariesdata-bindingoracle10grecommendation-enginesencha-touchapplyuikithidden-markov-modelsgocore-bluetoothfreebsdextensibilityprimary-keymlrcpdisposeresharpersdlcforkneo4jsimple-html-domworkflow-foundation-4rich-internet-applicationcode-access-securityhalting-problembibliographyunity-containerpaginghashcodescreendcomwixp2ptokenddd-repositorieskeyboard-shortcutscordovajavascript-eventselfbug-trackingscjpwindows-servicesapp-storecore-graphicsflaskmonitoringresponsive-designffmpegqt-creatorbigintegercompositionjava-7denormalizationasmxconventionlayersiliconbpmc-preprocessorreturn-typevb6-migrationlinq-to-xmlnumerical-methodsformattingplayframeworkapplication-planningentity-attribute-valuepriority-queueironrubytestcasesymbolspredictionredminemaintenancecomputation-theoryprojectionmaintainabilityforms-authenticationdatabase-partitioningpuzzleobfuscationbehaviorms-wordwebcamred-black-treetwittercommand-line-interfacedomain-modelinformation-retrievalimage-manipulationgenetic-programmingxquerymany-to-manyui-guidelinesreleasevideo-streamingc++-standard-libraryassignment-operatorergonomicslinq-to-entitiesosx-leoparddrycontainersmockitohidden-featureslexical-analysisadvertisingviewssnmpequalsejb-3.1oltprolesjunit4kinect-sdkrhino-mocksdirectx-11identitydisassemblingwinsockcfmlequalityaccelerometern-tier-architectureglobalizationtfsbuildsemanticsprivateui-patternsorganizationaggregationgetsizeprototypal-inheritancecalendarreplacemyeclipsepermutationnantscripting-languageactive-directoryvstoruby-on-rails-4function-pointersdesign-timelazy-evaluationperformance-testingwindows-phoneconstraintsstress-testingwebviewbnfserver-sideruby-on-rails-pluginssql-server-expressgoogle-chrometagssilverlight-4.0flex4.5packetiostreamprecisiontwistedhierarchical-datainformixmobile-websitesinatrainferencewaitb-treedumpallocatorpersonal-software-processaccessibilitymixinsshared-ptrantlrspatialflex4pipescalingtriggersgethashcodeassociative-arrayenterprisesystem-designcontinuous-deliverygrizzlypaypalcmdappceleratorscrapycouplinglistboxvisual-studio-2015passwordsamazon-ec2nonblockingfreenutchfuturecruisecontrol.netsyntax-errorbayesianimage-recognitionansi-sqlsvmpreprocessorfractalsdeadlockethernetfatbytecpu-cachescipyoverflownamed-entity-recognitionutf-8cassandraparser-generatorechokindle-fireformal-languagesspectrumienumerabledomainservicesmessagedynamics-crmrulescounthigher-order-functionssubstringmasmnotationblockingunions2d-gamesvocabularyraspbianfibonacciadalexercapybaraoracle-adfagile-processeskey-bindingsnservicebustornadoentity-framework-5simdfontsinner-classeswindows-ntregular-languageimperative-programmingthree.jsvideo-game-consolessmartphonedatagridviewreportflash-cs3hashsetsseusingastronomyface-recognitiongettercastle-windsorinterrupt-handlingcode-formattingerbcritical-sectiongetter-setterldapprivate-membersmapsaggregatenumerical-analysisgradleintlow-latencymoduloxlibdirected-acyclic-graphsconnectionvoting-systemjava-2dtclbootloaderstring-matchinginterpreted-languagetkinteramazon-mwsteamsystemciderweb-apierddeliverywmikeywordxmppramgeneratordtowcf-securitypokerbindflex-lexercore-audioprototypejsfriendplatformlinguisticsframebufferexpressionnamed-pipestablestublanguage-lawyerlinear-programmingshared-librariespackageoverridedistanceexerestful-authenticationpojolocalwindows-installernavigationhbasegoogle-chrome-extensionincrementxunit.netviewstategrand-central-dispatchiocpcontinuous-deploymentchildrenhangselenium-webdrivermobile-phonesmaven-2uiviewxssdirect3dfortran90csladuplicatessumpublic-methodwindows-store-appsproofyuiredmine-pluginsvirtualizationwindowvoicesingle-sign-onsql-azureiphone-sdk-3.0phpmyadmindrupal-6asymptotic-complexitygpsnormalizingregistrycodebasehostingcrash-dumpsremotingfinalizernotificationsperforceglobalexecutablesubclassconways-game-of-liferaiidatacontextbotspostindentationtext-processingtaocpcorrelationalsahookcubessednasmreplicationdfalocalereactjsvariable-assignmentdynamic-languageshuman-computer-interfaceinformation-theoryracketversionsvideo-capturetemplate-meta-programmingfactory-methodcode-injectionhdmiasp.net-membershipoctaveplotapplescriptwifibit-shiftcom-interopmainframeetlprototype-patterncollisioncellular-automatahierarchyansiprimitive-typesbitwikiscanfstylesheetmarkov-chainsmountenumerationcode-duplicationfieldbackgroundasp.net-3.5debianequivalencemenuemgucvode.net-assemblydrupal-modulespaginationlarge-datatemplate-specializationpredicatejenacallstackloaderpreg-replacechessrewritejax-wscmakefluent-interfacereliabilitygeospatialself-hostingvirtual-address-spacethree-tierbitvectordiagrammingowlkindlemulti-tenantjoglhidwebpagesettermedia-queriesgoogle-glassgeographymedicalclassloadermultiplayermd5generic-programmingeffective-c++distributed-systemexecforeachnoiseshellcodeobd-iivalue-objectshdlpddlcrc32emailtext-analysisruby-on-rails-3.2xslt-1.0compositenvidiatail-call-optimizationsolarisgroupingparentheseswicketipv4sipclipscategory-theorymstestminimizationgsmwindows-vistafopasp.net-4.0programming-paradigmsrubygemsmanaged-directxequinoxlensdijkstrajpa-2.0memory-addressrakecoffeescriptzoomwiresharkgdcompiler-warningsaccess-specifierdependency-propertiestarget-frameworkjquery-pluginswekamemory-barriersmetalandroid-emulatorautomakeopencvdotnetdreamweavervisitoradobefirefoxinstallationtelnetdeprecatedcomposite-componentgoogle-apirestletkernighan-and-ritchieflex3wifclickliteralsclangdosnameslanguage-constructcometstylecopsimulated-annealinghandwritingmicroservicesroutessvgfacebook-fqlembedn-gramroundingforecastingtransformline-of-business-apptooltippromisemarkupdecimalgalleryredundancycompareusing-statementdocx509loadallocationreinforcement-learninggdi+fluid-dynamicspointtuplesabstract-syntax-treesysadminweb-standardsjvm-languagestic-tac-toerankingisolation-levelacidnltk6502midiuser-storiesubuntu-9.04birtdashboardfile-uploadphotosustainable-pacerelationshipjfreechartftpfailoverclusterlibcdestructordeclarationerpsqlite3nginxriad3.jsuiimageviewdesign-by-contractvbscriptcronanemic-domain-modelfinancialrailoprerequisitespartitioningxcode4.2interpolationnsstringbootstrappingjesspolymorphic-associationsprotegeenterprise-libraryprivate-methodstail-recursionetiquettewhitespacequicksortlme4powerpointsizeofdefensive-programmingsyntax-highlightinglistviewbasentfsbridgerule-engineio-completion-portslxmljythontransactionscopegui-designstandard-libraryblazedsproceduremayamacrubycomplex-numbersdhtmltextmatenp-hardalt.netstar-schemasystem.reflectioncohesionfortify-sourcepimpl-idiomxcode5java-8twitter-bootstrapcurrencymsmqtextboxntosx-mountain-lionsmlnjinventoryelispwebservernsmutablearraydynamic-memory-allocationradsimilaritybiosdialognokogiriandroid-fragmentsstoragecurve-fittingtips-and-tricksg++cubedotnetnukelalrgpu-programmingxcode4.4multi-tierinstantiationinfinite-looppackagesbookmarkslotus-dominoemulatortemplate-method-patternkohanagroup-bycookiesms-officevarflashdevelopmicro-optimizationtoolkitlinear-regressionfxcopraspberry-pi2uiviewcontrollerdctsystem.drawinglow-level-codecopy-constructorsoapuirecurrence-relationdrag-and-dropservicebussemantic-analysispalm-osgototemporalpyqturiairwindows-8.1bitwise-operatorsaffiliatemicrosoft-test-managerrelational-algebraprinciplesqtranslatepuppetsoundexterraingridworldcomboboxc89quaternionsvolatilegoogle-apps-scriptlinq-to-objectscomputation-expressiontype-inferenceonion-architecturetortoisesvnmachine-codespark-view-enginedelphi-2007spring-securityconcurrent-programmingprismwaterfallcombinationschatqmlapache-sparkidlcode-reusesystem.reactiveinnovationsigintassembliesbackendgnomejax-rsgraph-databasesoverload-resolutionsecure-codingwindows-runtimerupcodeblocksibeaconcarbontaskmanagermainpath-findingcrystal-reportsbusiness-objectscontactsxcode4.5ecmascript-5productedaunit-of-workdomain-objecteconomicsolap-cubesimulatoreaidata-storagedata-annotationslookup-tablescinboundarymodal-dialogrecursive-querynokiawhere-clauseclouderavectorizationdjango-modelsrabbitmqnumpystdinocpjppart-of-speechaccess-modifierstitanium-mobileuser-defined-functionsrecvrichtextboxjvm-hotspotscheduled-taskscrmfactorialamazon-appstoremaster-pagesautocompletevsxsetup-projectacepandasblackberry-eclipse-pluginspam-preventionbpelspeechurl-routingmingwlspimplicit-conversiongraphical-programmingbuildersdljaxbfile-get-contentssymbolic-mathprocessingdweblogicmatplotlibshapewindows-phone-8java.util.concurrentmongoidgoogle-cloud-datastoresimple-injectorintersectionaspectjvidimensional-modelingbayesian-networksmouseeventcovarianceconsole-applicationttymultiplatformpascallibusb-1.0time-estimationbotnetcomputationclustered-indexhorizontal-scalingenvironmentjbehavewindows-server-2003msbuild-taskwordpress-themingjenkinsmsdnnaturallyspeakingpdoandroid-intent.htaccessclickoncerecursive-descenttrigonometrycom+returnmalware-detectiondecouplingmandelbrotmongoosemachine-languagellvmdelphi-xemultiplicationtraversalscoringblueprint-cssbreeze-sharpp-npmath.hmasstransittegraspring-batchlaravel-4liftcamera-calibrationmicrosoft-commerce-serverconceptualalicedecompilingddddnested-classoperator-precedenceruby-1.9ssclifinalcolor-schemerenamewrapperjulia-langnew-projectdefaultinnodblongjmpgoogle-closurecython32feetabaddressbookpdeautofacspecszosprimespylonsmochaherokuiscsiyagnismartyazure-storage-queuesshallow-copystdioaddtemporarysystem.outflash-cs5kanbanscriptletbroad-phasecustom-componentsbclscala-2.10gesture-recognitionscreenshotjoomla-extensionsputtracecubic-splinewebservices-clientrailstutorial.orgeffectsautowiredwcf-configurationacceptance-testingsamsung-mobilemodularinverse-kinematicsmodule-patternselenium-rccollective-intelligencetreeviewtemplate-matchingdtdnetduinobounded-contextsirvine32gtkcustom-actionjdeveloperclr-hostingwhite-hatdirectx-9dialectweb-partsdatagramentity-relationshipxbox360nintendorecordercomputabilitygoogle-visualizationzend-framework2directcomputephp-extensiondynamic-websitesgoogle-closure-compilermergesortacsjailbreakcontroltry-with-resourcestouchscikit-learngfortranpos-taggersubquerymsbuild-4.0language-switchingcommand-line-tooljmockjfifmember-functionsreference-countingdesign-decisionslistfieldios-simulatorcore-data-migrationwindows-authenticationupdatepanelquotingurl-rewritingpowerpoint-vbasts-securitytokenserviceevent-sourcinginstructionsrequirements-managementvisioaccountinggherkinimplicitsurvival-analysissql-order-byraphaeldata-compressionat-commandskip-listsrecordingaudiounitscrummasterarduino-unoobject-recognitionmonadsdroolsthrowawaycoordinatewildcardrandom-sampleinstallshufflehttprequestprogramming-pearlsformal-methodssdatastoreaudioqueuecustom-server-controlsasn.1http-status-codesnfawgetmalwarexbeeprocedural-generationjsonpextension-methodsleft-joinzookeeperbbcodedji-sdkonclickuser-generated-contentwritingcartrestful-urlinteraction-designrelevancesignaturefactdatabase-normalizationinternet-explorersencha-touch-2jslintqmakeapache-felixlanguage-implementationtexturesdata-partitioningavrontologypsr-2avl-treeobject-detectionmultiprocessorreadonlyweb.xmlehcacherx-scaladesignerconcatenationconvention-over-configurtetrisrtfmediafragment-shaderfixed-pointreferential-integrityworldwind32bit-64bitxsl-forootkitlogarithmpartial-classesdynamics-crm-2011quartz-2dsql-server-cestatic-librariescross-browserspring-integrationsmsmodel-bindingpoeaaapache-pigassignspring-data-jpabouncycastleenvironment-variablesavrcpmixed-modeperl-moduleargcapache2sanitizationpowerbuilderspecflowstarter-kitsdivide-and-conquerpython-requestsstruts2nullablejlabelphpspecresamplingtypescriptgasfrequencymacbookproliferayflat-fileadosocket.iojavascript-frameworkcommon-table-expressionsplpure-virtualwebpage-renderingradioxml-serializationprotectionhandlermono.cecilpalm-prepv3ddelaystatelesshateoastest-firstwindows-azure-storagejarvoid-pointerscustom-exceptionsmachcakephp-1.3design-guidelineswindows-xp-embeddedtransformerdigitformulaarrange-act-assertconditional-compilationphp-internalshqlsession-stateocslabelbittorrentlazy-loadingmulti-touchamazon-dynamodbtext-justifypurely-functionalandroid-servicebignumpollingsubscriptionextendscriptjscriptrpcaxiomamigadelphi-2009metasploitphonemazecloud-hostingcredit-cardopenearsquoteswatir-webdriverpreferencesmagentogoogle-closure-librarybackpropagationjni4netusb-drivevisitor-patternshardingevaldetectnurbsjavacvargument-passingshadrillthroughxna-4.0django-viewsc11spring-datadomdocumentobject-databasescsivtabletimingexpert-systemsystem-administrationedge-detectioncharcluster-computingtestabilityfunctional-dependenciesindesigndeviseinterface-designboost-mplmatrix-multiplicationclaims-based-identityaggregate-functionsrebuildsensorweightedevent-driven-designdeep-copyminifyy-combinatorregex-lookaroundsmulebidsstatic-constructorstreamingweb-frameworksvirtual-inheritancelarge-data-volumesbarcodeip-camerajtablecocos2d-xanonymous-functionglslesappendselfmeasuresmicroprocessorsperipheralshandlestmfinite-element-analysisapp-configpushhyperthreadingci-servercontinuationslong-integermarker-interfacesmultiprocessinginstrumentspapervision3dwxpythonclonejclweb-confightml-formcode-structureunits-of-measurementclass-table-inheritanceprimefacescoutoutput-bufferingminecraftxeon-phicrtpibatispivot-tableruby-on-rails-2symfony1leaky-abstractioncode-patchingapplication-designplayframework-2.0boilerplatedunituiscrollviewcursesdigital-signaturetfs2008githubswapgetjsoncontext-switchfluxmeteortemp-tablesmixed-modelsrepresentationsquarepyjamaselggparadigmsjdk1.5autosuggestpyopenclmaster-theorembreezesetup-deploymentasp.net-web-api-routingtransposejsp-tagsinoderttidjango-1.7traveling-salesmanunique-ptrknitrsplitsettimeoutplonesshobjectcontexttestngrexxcscrx-javantdllepollxamarinstrong-typingxamppdb2bankitunesreusabilityglossarycdcjrubydisassemblyllnugetbroadcastdecompositiongoogle-analyticsunsignednexttemplate-templatesmemoizationtimelineerror-reportingtexozcircular-dependencyvotiveparallel-extensionszipargument-dependent-lookuppower-managementnmakenoexceptteamcitywssassociativityforumsphinxgridviewendiannessadka2dphtml-agility-packcyphersingly-linked-listnumericin-app-purchasetable-drivendequestatic-memberscongestion-controlshared-objectsjavadocdraggableuartcollaborationsql-updateexc-bad-accessvoipsquare-rootsocialencogbasexvirtualembedded-resourcemessageboxlapplycircuitjstlcassandra-2.0pcrevisual-c++-2008-expresscstringactivemqstatakalman-filterwsgiintentional-programmingbllportabilityeffective-javamyisampinvokesurveyclockpie-chartios6externalsimpyreductioncocoa-design-patternsstring-algorithmibm-midrangeios7code-search-enginepdb-filesmanagerempty-listvaxrss-readertypo3monitorminixprototypingesb-toolkit-2.0gae-datastorewordpress-pluginnetbeans-7mesosmulticastwshrvalue-referencesummarydisjoint-setsthread-synchronizationintellij-ideaphotographytimezonelanguage-comparisonsip-addressiokitecmascript-6fuzzingcompiler-designgradientrevisionthread-local-storageweb-traffickendo-uiapplication-serverxcode7parent-childabstract-factoryxmlhttprequestdata-integrationturing-completeredirecttrackingoperator-keywordpolicyproduction-environmentpcdatabase-projecttypingabstractcontrol-flowaslrgyroscopecbc-macmicrophonecpu-usagerandom-accesslensesdecoderemote-controlhudsonconnection-poolingmaintaining-codeflowchartscadalync-2010spring.netreference-classfull-text-indexingjnienvstack-tracejoomla2.5error-recoveryportletaudioqueueservicesternary-operatorterracottagcc-warningmeshdisambiguationgcc6soa-suitesymbol-serverpdf-generationssas-2008midlproxy-patternhuffman-codingdiagramslaw-of-demeterquantum-computingownershiptabsdimensionms-access-2007adjacency-listapache-camelwsdlgacdocument-classificationpowermockitorigid-bodiesdatacontractsettingsmvccclosconfiguration-filesauditstdmapimage-segmentationmeasurementautoboxingpicbackwards-compatibilitybase-classsignedasp.net-web-api2network-scangoogle-spreadsheetmspeccase-sensitivetechnical-debtautofixtureaxis2helperangular-momentumtext-parsingmembership-providerselectorclrsservice-brokermwstitaniumremoteiomergewpf-controlsdalvikmethod-overloadingdjango-appscorsrpgledivisionmibcode-translationconcrete-syntax-treemultilingualobject-lifetimemonoidspayloadmathematical-notationdartphpdocvoice-recognitiongawkms-media-foundationlanguage68000glibcjathastochastic-process8086findthemespoint-of-saleendpointstessellationresponse.writemultitaskingguavadocbookmsbuild-propertygroupef-model-firstflex-mobilecomputational-financeseamcombinatoricsvectormathmoneymodelscode-cleanupjava-ioaddressingdjango-querysetxorgissequencenp-completediskurllib2mutual-exclusionlibgdxmedianvisual-studio-addinssamplingsleepminimaxdatabase-theorybuilder-patternoperationcomputer-science-theoryburndownchartsopenbdzigbeezopeembeddinginstallerkshgravityelasticsearchuserandroid-canvaspaintssmswcf-bindingextendpowershell-v2.0dicomgeolocationproduct-managementconfigurehdfsvideo-processingpremature-optimizationautoloaderscheduledexecutorservicelocal-variablesiqueryablecss-floatwix3.6gnuplotgraphicgoogle-chrome-osextractcommand-line-argumentsscreen-capturecodeccopy-protectiondurationlexical-closuresjava-ee-7preg-matchfedoraiifeblueprintlegacy-databaserdfapowerpcc64thread-priorityjgraphtwampprefixinteractionfortran77failoverexecutorgpioconceptinlineobject-modelrhinohtml-tablebeagleboarddata-transfer-objectsleadmultiple-dispatchfacebook-graph-apicrudwatirdmamappingradio-buttoncode-designinterface-builderloose-couplinggreedyshadowpyobjcsmpdatabase-migrationcomputer-forensicsvoronoilibjpegserial-communication32-bitmyfacesheap-memorywcf-clientsublimetexttlbjava-streamexponentiationservicemixmahoutdecoratornullpointerexceptionphp-5.3imagemagickoutlierspivotamazon-marketplacegit-mergeadd-inevent-simulationpaxoshigh-loaddrivesflash-builderstereo-3dmanaged-c++zend-viewpearcode-readabilityeraseflyweight-patternsuffix-treebeanshellofflinejavascript-objectsagentboxingmodern-languagestest-data3d-modelexportpublicassetsmojobackground-subtractiontrafficzenossshellsorttabletuitextfieldbranch-predictionfaceted-searchopencartreportviewerstandards-complianceisabellecustom-eventsbipartitedense-rankwizardsecure-sclevent-listenerslinkifyoauth-2.0unsupervised-learninginternet-explorer-10distractionsx++smackderivativeautomappingtruncater5rsstdthreaddocumentviewerdocument-managementbluezrust-dieselmacbooknhibernate.searchlockscgpdfdocumentproducer-consumermysql-workbenchcompiler-optionsexploratorydereferencefloating-accuracychromecastmicrocodinglabelsmsys2mouseovertwo-connection-limitweb-deployment-projectend-of-lifejsscproceduralwith-statementtabbaruser-managementsentiment-analysisjquery-selectorsmembusdotnetnuke-modulepsychoacousticsaero-glasshigh-trafficbackupfact-tablexamarin.androiduninstallbcintelrectleaderstringbuilderfakeiteasyjavacardplayframework-2.5vdspobject-initializersdynamics-ax-2009rcppdbix-classsunrpcneurosciencegtdmips32rating-systemsubroutineknockout.jsxenbuttonclickinfrastructureadomd.nethypervisoractionlistenermsdeployjasminequestion2answerdbicategoryjcespacenonlinear-functions.net-attributesnanivarcolor-managementsoap-clientroinotification-bardatatablecfcmultiple-monitorsjoysticklistingsjsf-2.2recordsetvb5class-instance-variablesuser-inputbabylonjsmfccscrumboardretrospectivesclass-methodenergyfacadestdoutelementadminfont-lock-modeglsurfaceviewcalculusinteger-overflowvoidexpansionuicollectionviewlayoutportraitdenotational-semanticsqdatetimeicommandmandrilllnflowdocumentgoogle-booksquerydslmac-classictuimanagedobjectcontextsapigeneric-functiondataformrspec-railsvalueupnpvs-unit-testing-frameworkspiswigaggregaterootcommit-messagepylintdigitaliphone-privateapiflash-cs5.5angularjs-factorycyrilliclibtoolsnmpdsequence-diagramviola-jonesexecutiveshole-punchingentity-framework-corestocksimplicit-typingrosmodbusgzipipv6crypto++aliascss-selectorsddd-servicevisualsvn-serverirqgoogle-pluspage-load-timectypeswininetevent-based-programmingservice-discoveryblendinggarnet-osinfraredcontinuousxml-parsingnsarraycontrollerinventionsotpdmpmexdsaoxygenegamepadcss-frameworksbezier-curvecappuccinomemory-segmentationinit-parametersfpsgnuradioeclipse-pdtopendireulaphasebuild-errortableviewbatch-processingcode-documentationdetectionunobtrusive-javascriptandroid-layout-weightcasablancacase-classhttp-status-code-403cloud9-ideceleryconfiguration-managementinternet-explorer-6google-searchanonymousunmanaged-memoryscala-collectionsdoxygennioandroid-bleparasoftautomated-deploybacklogname-lengthcp866betamasm32clssosexexpression-treesbinary-operatorsuser-agentprinter-control-languagedistributionillegalmonitorstateexcephaxeusage-statisticssbthttpclientaddressing-modeopcparallaxrendermemory-modelosgi-bundlesql-subselectpacmancoding-efficiencyheightmotorolaair-androidregister-allocationprofilesproj4jquery-ui-pluginsminimalmodbusbusiness-rulesaudio-convertercplexdjango-templatestimtowtdiscreen-orientationlegosolr-celldmdquantifiersfipstext-to-speechseasidemp4gnuradio-companionhelpermethodsrubocoptype-librarymodelbindersoverheatingderived-classglfwsmtppitch-trackingrmarkdowntree-balancingtexture2ddevtoolsopenjdkmagic-numbersndefruby-2.2polygononmouseoverendorsedmicrosoft-metrocurly-bracesgoogle-mapsdotnet-httpclientfetchasp.net-coreteradatalcseclipse-gmflimitsocial-graphbitconverterucabsplinespring-webflowdrupal-themingsieve-of-eratosthenesz3er-diagramsjboss6.xcomparatornapebacktrackingxml-rpcwidgetsunstudiolocaldbundoruntime-errorbufferinganchorgit-commitnsimageamortized-analysisjavasoundrichtexticuadldsdynamic-loadingdefault-valuecoldfusion-9tmparameter-passingnsblockoperationadaboosttest-planenterprise-architecttstringlisthpcdevice-contexturl-validationaffinetransformnet-snmpgladestringstreampassword-hashmemory-fencesrunspaceshfbms-dosobjdumpribbonbigtablebrownfieldcontourcallbynameprepared-statementjtextfieldassembly-signingadministrationgen-eventlogical-operatorstagfilelong-doubleequivalentinterface-implementationcentercursorgoogle-earthuipopovercontrollernstimeramqpmixture-modelkeyloggerbackground-imagetesting-strategiesvirtual-machinexamarin-studioinfopath2010calayercode-first-migrationsvolatilityjavafx-8wmlreturn-value-optimizationdotnetopenauthandroid-sqlitedropwizardtrunkcore-locationreflection.emitsqlclrsql-server-2014-expressasset-pipelineflatperspectivevisual-c++-2005contractsecurity-rolessanitizeunion-findstatechartstakerberoscollaborative-filteringcrosstabbubble-sortssjscustom-error-handlingintranetsolutionakka-clusterbazelnsaffinetransformbitcountbulk-loadbusyboxtradingsingularmarshallingkeep-alivexnanimationdouble-dispatchurlopenget-requestprincipal-componentshypothesis-testnotnulldirectshowkinect-interactionstdvectorxpslisp-2atomedit-distanceprogressivedeployment-descriptorodeintansi-92nsmenuitemserializablearray-initializationmustachedatabase-integrityruntime-compilationjquery-uiundefinednon-staticgattparametric-equationslsaroundhousestripestask-trackingalarmmanagerdefaulted-functionsalgebraic-data-typesmorfikhsmraw-socketsnetfiltericefacesassimpgreasemonkeyevented-iogenuinechannelsr-gridmultiple-tablesgoogletestdataflowsize-typemultimethodcapitalizationjmockitrubymotionxor-linkedlistcompass-geolocationssairepositoryqtquick2set-covermem.-efficient-linkedlistjtagoutputradrailssiebelmanagedsdpwavefrontdlnaubuntu-14.04mapperrootgroovyshellsequencescompass-sassienumeratorfunction-overloadingyoutube-data-apiobject-role-modelingwss-3.0s#arp-architectureaforgevariadic-functionslilypondnumber-theorysonarqubeactivitiactivity-monitorasp.net-mvc-areaslyncrelational-modelfactor-langlogic-programmingpickleprims-algorithmc++-ampjspincludepaddingmemory-corruptionopenpgphfilelisdocstringxcode5.1cjksliderplaybacksize-tconceptual-modelfeedsmtajoomla3.0ext3elastic-beanstalkcodigettextmove-semanticsmobile-applicationantlr4topologyuploadnull-object-patternactiveresourcekettleshopifyflood-fillface-detectionscreen-sizearbitrary-precisionfat32remote-accessintegralamazon-fire-tvbackground-processmefshoppinglibvlcaxsfinaeparallel.foreachstate-managementhttpwebrequestdependent-namejasper-reportsandroid-runonuithreadansi-sql-92j9chaosliterate-programmingcopy-assignmentwaitpidplacementvxworksheadaveragetensorflowhardware-accelerationuiview-hierarchycapistrano8051game-loophdcpogg-theorafeature-drivenwmfcodepagesarrowsha256script#kernel-modeproject-organizationcouchdbimage-zoomfinallypalm-pre2qt5backlightedidefaultmodelbinderacr122flushoutlook-vbaapache-portable-runtimephantomjsvirtual-pathcardinalityvisiondelphi-7pbxlibavirbx509certificatecshdockpanelyuvembedded-databasemotion-detectionss7openid-providernodesfitch-proofsopen-closed-principleui-helperoracle-ucmchange-data-captureskinningrmscairngormbinary-heapplyrfreeglutlines-of-codegoogle-style-guideoverridinghttpartyfseekpostswavdynamic-reportstranslatetomcat8roxygen2forgot-passwordschedulermixerieee-754netbsdexchange-servermsbuild-targetinstancesanonymous-inner-classvideo-editingoracle8iweldlandscapeswi-prologandroid-loadermanagerin-memory-databasefoafglibthreadgroupworkflow-enginelibc++linodemercurialdouble-checked-lockingautotoolscxfmaven-javadoc-plugincustom-eventsubjecticonshaskell-platformhardware-programmingexecutorservicetype-conversiontwiliowindows-identityentitiescache-controlsaxonout-of-memoryprintersdeclarativeintrusion-detectionwcf-restsilverstripecsrfdataframemultiple-indirectionrationalestreambufdatabase-firsttao-frameworkportfoliocqlcross-domaininstallshieldreallocpre-incrementlokiubercartbessel-functionsfile-conversioncomparablestarling-frameworkcyclicbarriernscoderdigital-logicturboc++agent-based-modelingoledbphotoshop-cs4lib-nfciphone-sdk-3.2svdnswindownegationfile-descriptormediacontrollermingw64cpythondatabase-tablehlslsassblockingqueueinterlockedchange-passworddecision-treepresentation-layerphpstormwapifftjson-apirefsaltcontainsstartupcadrecursive-datastructuresphylogenyupperboundgit-gcdata-entry.net-remotingjavafx-2sound-synthesisdesign-rationalegoogle-codegoogle-play-servicesgmailhoistingstm32texnic-centerosbmatlab-cvstoracle-coherencethread-localdata-profilingexecutable-jarsimultaneousrecurring-billingnumbafortran-iso-c-bindingsgigprsas-ifproject-layoutmechanizelocal-storageuigesturerecognizerguicewebdeployfeature-detectionminesweepersyntactic-sugarmanifestproviderwebservicehost3d-reconstructionmachine-translationsoftware-estimationtilesdatabase-managementjfacetaxonomyonline-repositoryhttpcontexttable-variableconverterinvalidatelua-tablec++buildercross-compilingtype-constraintszend-studiopopularityzshautolayoutdllimporthamlwebmatrixapplepayvisual-c++-2008triangulationnuget-packagecpanelfont-sizerefreshgraph-coloringgoogle-calendararm64sourcegear-vaultgetlatestyield-returncredit-card-track-dataexchangewebserviceslrusapfrontpagegroebner-basistreemapthread-specific-storagegoalironkey-value-codingvisualvmvisual-foxprojoomla1.6ibplugingtk3fast-espbox2d-iphonemotionnsoperationlcdspec#first-class-functionsfuzz-testingflexunit4virtualhostwpfdatagridswingbuildergit-tagcpfreebaseuiimageunmanagedanonymous-methodssitecoreoutlook-addinregression-testingwardenazure-documentdbfinal-classhard-codingapache-tikadvorakcppunitintegritysharepoint-2013companion-objectmac-app-storelotussupervised-learningconcrete-inheritancegetchmmapyahoo-financevmwaresliceapache2-modulemod-sslgridrisk-analysiszend-aclhammingweightwebsphere-mqlong-pollingcucumber-jvmhapijsreference-typeinjectsimplemembershiphectorprivilegesssrs-tablixrvaluenormal-distributionjxtavector-graphicscompound-operatorumbraco-blogclasscastexceptionasp.net-mvc-5invariantsmemory-poolstatsmodelsgenerativeasyncsocketregex-greedymsbuildcommunitytasksidentifiercrackinghash-collisiondelphi-prismdataproviderterminationmultiple-columnsrestifymonomacburnobservablecollectionscikit-imagecherry-picksniffingmethod-namesandenginev8compass-luceneimage-scannercdbdigestmutableweblogic11gsysvshorthandnstreecontrollerkarma-runnerrdbms-agnosticparameter-sniffinggnupgmysql-managementfindbugsmptttexture-mappingnhibernate-mappingmysqldumpu-bootcustom-buildmailslotacronymreorganizemahjongjboss7.xabstract-methodscounterbeautifiermessage-loopqgraphicssceneyoutube-apicoordinate-systemshttphandlertemplate-enginejdoautomatondelphi-5silverlight-5.0nice-languageportsgnome-3morphiafreertosredoquadtreegalaxyqgraphicsviewknuthhp-uxmayavigreatest-n-per-groupinclude-guardsactionresultencryption-asymmetricglewaccess-tokenstagingconcreteonpaintbrowser-cachetcshappframeworkniosfscanfoverlapped-ioeclipse-emftrampolinespersistence.xmlheader-onlyusb-mass-storageuitabbarcontrollernpscsftpl-dataflowpysideolexml-attributecopy-on-writeminimum-spanning-tree2-3-4-treeunpivotcodeplexswift2splinesql-deleteminimizelifecyclesrsfasmgriffonyqlvirtualboxoctreepredictprogram-flowshippingfilestreamimage-rotationgoogle-gdkchemistryipodssrs-2008appletpython-imaging-librarysafaridiscrete-spacecoldfusion-8recordsdrop-down-menuconcattemplate-haskellcalculated-columnsbeginreadxml-validationgrantclpqsymbolcircuit-diagramlightweight-processesidiomatic-perlimpersonationobject-initializationfeature-extractionmaven-3nested-loopsvisual-studio-expressclionexplorercheckboxcross-validationtyruscommentingusing-directivestouchscreentypesafe-activatorumbracox509certificate216-bitpygtkcomposite-keyexpression-evaluationcode-behinditerableadfslarge-filesaudio-recordingtr1qgraphicstextitemuieventelliptic-curveownerdistributed-cachingnsmanagedobjectrich-domain-modelcontravariancebigdecimalbare-metalcircuit-breakersysinternalsmockupssquishgrails-2.0parsekitfwriteaccessorybrute-forcemit-scratchnetbeans-platformaudit-trailpacket-snifferslate-bindinglistenermongodb-phpmsbixllpegormdatabase-tuningruby-on-rails-3.1spring-restcontrollerkerningwaveletbinary-compatibilityalertsgnatcgpdfscannerscalar-subqueryddlcellular-networkcan-busbit.lyfile-extensionevent-loopclass-hierarchymoosepreg-match-allflagsantivirusnoncopyablemedia-playeralloyrefcountingportalmatchingconst-correctnessandroid-studioinner-joinui-threadscheduleinterceptkiffluprgbecmamfiwhite-box-testingmodemdagger-2metapostdmlgpuimagecircular-referencestack-smashtransitivityremindersopenid-connectround-robinwtsap-connectorduplexocmocksystem-verilogentropystatusbaraccess-controltablelayoutalexa-skilldelegationgalaxy-tabtostringwxwidgetspos-taggingidempotentstabilitydata-cleansingasset-managementfile-permissionsrefactoring-databasesappkitcontext-specificationintellitracerpnscaleebnfdomxpathcommitmost-vexing-parseionictodosui-testingbindingsourcehexrolapfluorinefxbreakpointsoffice-2013color-spaceposix-apiradix-sortjlistargventry-pointweb-application-projecttext-filesdifferencepayment-processingskyfieldservice-layerlaunchobject-object-mappinghuman-readablejdbctemplatetypetraitsspray-jsonmozartfisheyecashomebrewcommerceuniquexslt-2.0windows-kerneloracleformspointer-conversionputcharjquery-globalizationedirectoryfiberrustpost-incrementkissfftbin-packingdelphi-xe2cortex-auinavigationcontrollernon-exhaustive-patternsdistortionequalizerline-intersectionslugspinlockslowdownscreen-brightnessvspackageerasureweb-config-transformmaybecode-migrationnsbitmapimagerepautomatic-ref-countingclass-variablespppuniqcygwinkinect.toolboxvirtuemartsimplyvbunitre-engineeringsudokulocaltimepharoiis-expressbeagleboneblackisbnteam-buildscrollinihidden-fileshungarian-notationstripe-paymentsimpactjsgnu-toolchainusability-testingoculusnsbuttoncellwebspherepowerpivotlibsvmevent-logpath-manipulationfirebugreferential-transparencytestdrivendesignpowersetdelimiterfunction-objectfirewalldelete-filejsdocvirtualallocdrmcycleidataerrorinfoblendthriftchecksumhadoop-partitioningrootviewcontrollershift-reduce-conflicthoverdomain-service-classintellij-13callocopenjpaoffice-2007scope-identityy86unionvrlibusbapi-keymicrosoft-fakesunreal-development-kitcard.iomemory-efficientosloxnuautomapperef-database-firstimage-enhancementdfsvpsmpegbitarrayxcode4.3avx512distinctcommodoredividestorage-class-specifiertrussstreet-addressprogram-structureselinuxjqtouchspatial-queryjustmocksingle-table-inheritanceparentopamnsbuttonjquery-ui-timepickerireportgwt2session-hijackingdefaultlistmodelrowremote-serverapplication-integrationinstance-variablesandroid-widgetvisual-studio-sdkdouble-clickkendo-mobilecompiledderivedalexa-skills-kitstructured-programminghttp-errormootoolsl-systemsbasicanalysis-patternsbapiios9.3gnu-smalltalksse2spring-data-neo4j3dsodatalmdirectx-10drawrectcomparison-operatorsjxcode7.3aixamazon-storedata-generationgoutteleiningenmisusent-native-apiqtcpsocketia64autoiphone-accessorysmartcardstorewhereinsertion-sortssdtboost-date-timemagnetic-cardswebrtcandroid-frameworktfs2013business-layerintermediate-languagespring-aopc#-6.0nomenclatureentity-modellgplsharedplyrgoogle-tvtimertaskclass-attributesphotogrammetrydcidata-drivenstanford-nlph.264ocpfilechoosersurfaceerror-correctionbitspymccapturexperfviterbivelocitygprofdatamartsemicolonpublishingboost-graphmouselistenertelerikshort-circuitingfeedbackios-ui-automationbinderlatencyopenjmsnumerical-recipesraspberry-pi3eclipse-emf-ecorejfilechooserquantifydarwinrdlcdecompressionmmunested-urlseigenup-castingwebosrequest-cancellingaccelerated-c++vc6lldbhill-climbingdifferentiationpostfix-notationngroute.bash-profileappstore-approvalwebdavcode-conventionsgraphics2dgraspuitypeeditorcompatibilityconstexprdeterministicconsistencycryengineemvandroid-2.2-froyoappdatajs-test-driverresultsetektroniframeforward-declarationpostscriptsoundcardpathgeometrypowershell-remotingpy2exehtml-selectlook-and-feellanguage-conceptsxsd-validationtransducernsstreampanlower-boundiec10967scapyclojure-core.logicmelregex-negationhibernate-mappingpartial-viewsselectlistgoogle-api-clientfile-organizationscrapersingle-page-applicationaccess-vbacrc-cardsjavacctweetsfoundationinteractivelogitechstatefulrowslinearizationstringbufferistringstreamthinitextostreamqueuingledpyserialreactive-programmingretainbitflagslpcpointer-arithmeticzombie-processconcurrenthashmapcreationzend-authdynamic-language-runtimeedit-and-continuecalculated-fieldevent-dispatch-threadqprocesstopic-mapsdaggeridentity-operatorsealedeachsim900haskell-modeelementsaspects3-tierandroid-syncadapterovertonehtml5-canvaspowershell-v3.0lookupdependency-managementpublic-keygunicornopennlpmozillarabbitmqctlmechanize-rubypgpjsonpathvisual-c++-2010erase-remove-idiomsonosexplicit-conversioneloquentopendatawebbrowser-controlscientific-softwareruby-1.8suitenescgaussianquery-performancedrawstringsession-timeoutapplication-structuregetcharjlsmosstomcat6bold-delphijscript.netisp-principleobjective-c++blockpysparklinecobol85usbserialsummarizationwebdriversqlalchemynumberpadslidemodularizationpreloadinginstruction-setopenalz80custom-attributesservice-referencemsp430ninject.web.mvcpenetration-testingshell-extensionsimage-capturesynchronizealignmentmatchretina-displaycore-textexecution-timezeromqwindow-functionssecond-level-cachestatic-filesjboss-portalexternal-accessorysystem-analysiscustom-membershipproviderwidthgnu-makeopenslbackbone-routingn-layerglobalsdynamic-assembliesnetbeans-6.9uibezierpathservlet-filterstandemqvtjavafx-12phase-commitimageiconnsubstitutedata-tracingsemantic-markupmatlab-coderrails-activerecordgraphical-logoplaying-cardsdrupal-themesisolationmolesadventureworkspypylinq-to-datasetblowfishrowlockingunity5wchar-tpositioningiis-8restkitasp.net-mvc-beta1naglegoogle-oauththread-sleepweb-deploymentvalgrindios9clauseios-universal-linkswcag2.0pyephemview-model-patternlinearsystem.arraypuppet-enterprisesupervisordodp.netwcagandroid-bluetoothgraphingqtablewidgetsessionidcgaffinetransformundo-redoasp.net-core-mvcexport-to-excelrspec2iptype-aheadvgathrowabletraining-datatreapsparqlyesodvisual-studio-debugginghttp-status-code-404in-placeservicehostdjango-celerybox2dnonlinear-optimizationnprreversionjetweblogic12cinformation-visualizationmoaiwindboolongdata-collectiontomeelamppython-db-apihindley-milnergruntjsgoogle-analytics-apipodnative-codebounding-volumepolicy-based-designskinavaudioplayersubmitperformance-estimationhttppostedfilebasenmapopentksparse-matrixencodespring-elandroid-sourceproxyplovrpyqt4facebook-chatreasoningbackbone-viewslogistic-regressionselflanguagecoverflowrational-unified-processhttp-requestmouseenterword-frequencygit-cherry-pickcapprolog-topleveldoctrinefolderscbperipheraldiagnosticside-customizationfixedpagepywin32java1.4url-shorteneruiimagepickercontrollerhotswaptimespanhpricotsharepoint-apionclicklistenerunresolved-externaloculus-runtimestrictxorgmidjeemail-spaminvokelaterpentahoudevalphablendingupgradewebshopado.net-entity-data-modelsqlyogdynamic-castimmutable.jsresource-contractsproject-templatezippersystem.diagnosticsboidsvisual-studio-templatessniffercontrol-charactersegovernmentxml-signatureloadlibrarystochastictrieeasymockvariable-lengthapriorifogbugzquotationsfusetwos-complementshelvingsinglepageweb-site-projectcorbanlmelight-injectfaultwsclossless-compressiongamingxdt-transformformatsalesforceidispatchwcf-ria-servicesmemory-mapped-filesthreadxintel-edisonaccountmanagerc++03activex-documentsdefault-constructortargetbreadth-first-searchswcexittelephonytbbspritelowpass-filtersconsxaequality-operatornon-typememory-editingwinrt-xamllrculturetransactionaljob-schedulingfilesystemobjecthtml5-kickstartwireframesamlcontrol-structurequery-tuningapplication-layerw3cparticleintel-micpngraycastingcombinatorsemtransaction-loghtml-content-extractionperiodprivate-keysigilskolmogorov-smirnovcontext-boundx11documentation-generationdeclarative-programmingncursesunordered-mapbarcode-printingvalidationattributemod-perljavassistcaliburn.micromscapihttp-headerspyopenglazure-storage-blobswindows-embeddedcommercial-applicationcharacteristicsactionsimulinkgranularitycryptoapiprotocol-buffersocunitgreen-threadswindows-integrated-authpidscalatestprogressdialogscenariosdbunitpowershell-v4.0stubsedifacttypographycore-imagentpindexofasterisktfs2012resource-managementdata-consistencywinddknpmcoldboxhtml-listsilasmuicollectionviewnopcarouselcs50rdocsrandcross-correlationwindows-explorerfrebinstagram-apipostordervisualdesignerlexical-castmenuitemdynamic-arraysjava-ee-5dynamics-crm-4tildefile-sharingdjango-urlsoverusestored-functionsoptionscreateobjectbibtexrubymineironpythonqtableviewreducingnsdatamod-rewriteisoblobchomsky-normal-formwin32guitightly-coupled-codecomment-conventionsdocument-databaseoverwriteandroid-sensorsdespass-by-rvalue-referencelspictureboxcontractsactivesupport-concernuibuttonmethod-signatureinterpretationasp.net-controlsspell-checkingobject-oriented-perlstring-substitutionpowerbuilder-pfcwindows-95servercontrolspitchzseriestransitionsglkithornetqtype-providerspostsharpiommussdamazon-snsplaneweb-controlsautomatic-propertiesbrokertre-libraryspellingpygleteasyphpqthreadapproximationjcanvasstring-lengthhrefweb-farmmapkitmsysgithp-nonstopcontroltemplateslatitude-longitudesimplifyvoxeltesseractmulti-table-inheritanceproperties-fileioexceptionevent-storeobject-createclearcaseidocscriptmethod-chainingextreme-feedback-deviceshamcrestmongodb-queryida-prosurfaceviewdjango-ormprivate-constructorpromptvmallocumtsalunstimeintervaladtinter-process-communicatwifstreamhsqldbpcmdocumentdatabase-restoreviewresultspecializationdepth-first-searchestimotesuppress-warningswin64god-objectfaceboxavassetreaderhttpresponsemnesiaopenmpipetapocominikanrengeographical-informationvipsgotchasmongodb-csharpbundleexcel-formulamissing-datapageloadstrict-weak-orderingmapping-modelexcel-2007navigation-drawerkextrender-to-textureclojurescriptmodula-2directed-graphangularjs-serviceattsilverlight-3.0dftdemoservice-locatorcorrectnessperl-data-structuresboolean-expressionnuget-serverdecodinggsoapcase-insensitivenxtrfidlightingflowlayoutpaneldjango-admincircular-bufferunrealscriptjgroupsaudio-processinghiveabapvncside-effectsprofilerknnstatic-typingprotected-modefirst-order-logiccode-by-voiceansi-cdirectoryservicesinterpretedlocklessnsimageviewuicomponentsws-federationusernameowinurl-patternwmi-queryqsortcls-compliantaccelerate-frameworkformatted-inputsafety-criticalargument-deductionstring-comparisonservlet-containerexpectalterjxlheap-randomizationuseridextjs4shtmlrow-numberrelative-pathviewmodeloccasionallyconnectedpowermockfacebookeraudio-streamingpage-lifecycledeferredberkeley-dbnamed-entity-extractiondoubly-linked-listvertex-shaderfacetd2rails-routingrtpshortcutexpression-templatesindustrialwhmdaxbpmnstringtokenizerspreadsheetinitial-contextbuild-scriptscalaralexa-voice-servicepipelineray-pickinglinesazure-active-directoryimageviewresponsesetjmppolyhedraunificationmessagesarduino-idelagsqueakintervalssetfocusorchestrationnao-robotandroid-permissionsthrowjbpmtimeoutexceptionyarndeep-linkingone-to-manypipeliningidocrelative-addressingwildflystaruml.net-corepalindromeandroid-uixulrunnerduck-typingamazon-elbpingreverseperspectivecamerasql-server-2008-expresspixelmetatrader4variable-typesfoxproswingworkerxtsjekyllshared-nothingactionscript-2apkeaaccessoryhtml5boilerplatestatic-factorymmslibxml2swizzlingapache-spark-sqlpolynomial-mathphobosucmafgetccbirheightmapjoptionpanesublistflash-messagevlcaccessorsavonriscwebhttpyui3xjcdatabase-administrationfinite-state-machineopc-uamember-pointersmindstormsspring-profilesstructuremapprettyfacesdna-sequencecondition-variablejndiwcf-hostingbracespresentationcatalystjquery-tooltipobjective-c-categorynsisaplcreate-tableseriesnswindowcontrollerdatabase-replicationdecrementmathematical-expressionsviewbagitemgroupjboss-mdbdecltypesequentialfaceletsrepeatsdl-2real-modedo-whileext4sitedesignprolog-difc-librariesiis-6context-sensitive-grammarflowthe-little-schemershiftia-32sybaseseeklog4jqt-designerreactiveuisftpnsregularexpressiondbcontextadjacency-matrixtracingbuild-systemcartesianchannellinux-distrosehc++-conceptsroslynhadoop-streamingrgsdirent.hvsewsspartial-specializationamazon-s3netshpatchboost-asiolow-memoryserialversionuidrs485visual-web-developerinputstreamvisual-studio-2003image-conversiondelphi-6dotnetnuke-imcmit-schemeentitymanagersignalrunique-constraintlocalstokenizeplpythonchunkingboost-anycpu-speedpage-tablesfilteringinformation-hidingshapefileyasmfractionscpancasevirtual-destructorobject-pascalsql-server-2014event-based-componentseclipse-gefverificationdepth-buffertext-extractionrelaycommandorientdbembedded-languagenotifyhypertalkpci-emarklogiccartographyaddsubviewjbuttonsuspendmach-o.net-micro-frameworkcatalogsts-springsourcetoolsuitemasterstellentcss-specificitylevelsconnectionssandcastleurllibldpresenterchicagobossprototype-programmingduplicate-removalcmake-guitype-systemsdocument-readyuuidconnectrecurrencesublimetext2firebirdjquery-effectsappiumoauthis-emptyfind-by-sqlhypermedia3d-modellingusergroupsvnc-serverroguelikesuperclassinsightbusdynamic-scopefunction-templatesandroid-mapviewbytebufferfunction-pointsrights-managemententity-framework-4.3identity-mapspatial-indexfibonacci-heapstatementswhite-boxopencmsdatabase-agnosticnetmodulessparcdecompilerarmcccakephp-2.0azure-web-rolespikecross-productlotus-notesnspredicaterobotandroid-navigationviewps3securityexceptionappdomainblendersql-scriptsdemoscenefancyboxextendspiautomated-deploymentnoscriptdxgitouch-typingjava.util.scannerpython-3.3django-staticfilesgenerative-artpci-dsscancurryingnonetypesql-execution-plantaggingambaatomicitymotion-planningaccurev6510adhoc-queriesmongodb-rubycircular-listsystem-requirementsforumshidden-fieldframehttp-getwavec++98cap-theorembiological-neural-networkautoclassoracle9iclass-visibilityfile-readfluidurwidzend-formhostnamewindows-shellresolutionandroid-dialogreducersitanium