We analysed more than 40 000 000 questions and answers on stackoverflow.com to bring you the top of most mentioned books (5720 in total)

How we did it:

  • We got database dump of all user-contributed content on the Stack Exchange network (can be downloaded here)
  • Extracted questions and answers made on stackoverflow
  • Found all amazon.com links and counted it
  • Created tag-based search for your convenience
  • Brought it to you

For any feedback, any questions, any notes or just for chat - feel free to follow us on social networks

Recomended tags

Top web-services books mentioned on stackoverflow.com

Domain-driven Design

Eric Evans

Describes ways to incorporate domain modeling into software development.

More on Amazon.com

JavaScript

Douglas Crockford

Describes the reliable features of JavaScript, covering such topics as syntax, objects, functions, arrays, regular expressions, inheritance, and methods.

More on Amazon.com

Patterns of Enterprise Application Architecture

Martin Fowler

This volume is a handbook for enterprise system developers, guiding them through the intricacies and lessons learned in enterprise application development. It provides proven solutions to the everyday problems facing information systems developers.

More on Amazon.com

Code Complete

Steve McConnell

Features the best practices in the art and science of constructing software--topics include design, applying good techniques to construction, eliminating errors, planning, managing construction activities, and relating personal character to superior software. Original. (Intermediate)

More on Amazon.com

Head First Design Patterns

Eric Freeman, Elisabeth Freeman, Kathy Sierra, Bert Bates

Provides design patterns to help with software development using the Java programming language.

More on Amazon.com

XUnit Test Patterns

Gerard Meszaros

Improves software return on investment by teaching the reader how to refactor test code and reduce or prevent crippling test maintenance.

More on Amazon.com

Framework Design Guidelines

Krzysztof Cwalina, Brad Abrams

A new edition of this title is available, ISBN-10: 0321545613 ISBN-13: 9780321545619 "This book is an absolute must-read for all .NET developers. It gives clear do and don't guidance on how to design class libraries for .NET. It also offers insight into the design and creation of .NET that really helps developers understand the reasons why things are the way they are. This information will aid developers designing their own class libraries and will also allow them to take advantage of the .NET class library more effectively." --Jeffrey Richter, author/trainer/consultant, Wintellect "Framework Design Guidelineswill help you in two important ways. First, any .NET developer will benefit from a greater understanding of the design principles that govern the .NET Base Class Library. Second, a deeper understanding of these principles will help you to create software that integrates well with the .NET environment. Quite frankly, this book should be on every .NET developer's bookshelf." --Bill Wagner, founder and consultant, SRT Solutions, author ofEffective C# "Not since Brooks'The Mythical Man Monthhas the major software maker of its time produced a book so full of relevant advice for the modern software developer. This book has a permanent place on my bookshelf and I consult it frequently." --George Byrkit, senior software engineer, Genomic Solutions "This book is a must-read for all architects and software developers thinking about frameworks. The book offers insight into some driving factors behind the design of the .NET Framework. It should be considered mandatory reading for anybody tasked with creating application frameworks." --Peter Winkler, senior software engineer, Balance Technology Inc. "Frameworks are valuable but notoriously difficult to construct: Your every decision must be geared towards making them easy to be used correctly and difficult to be used incorrectly. This book takes you through a progression of recommendations that will eliminate many of those downstream 'I wish I'd known that earlier' moments. I wish I'd read it earlier." --Paul Besly, principal technologist, QA "Filled with information useful to developers and architects of all levels, this book provides practical guidelines and expert background information to get behind the rules.Framework Design Guidelinestakes the already published guidelines to a higher level, and it is needed to write applications that integrate well in the .NET area." --Cristof Falk, software engineer Framework Design Guidelines: Conventions, Idioms, and Patterns for Reusable .NET Librariesteaches developers the best practices for designing system frameworks and reusable libraries for use with the Microsoft .NET Framework and WinFX. This book focuses on the design issues that directly affect the programmability of a framework, specifically its publicly accessible APIs. This book can improve the work of any .NET developer producing code that other developers will use. An added benefit is a collection of annotations to the guidelines by various members of the Microsoft .NET Framework and WinFX teams, which provide a lively discussion of the motives behind the guidelines, along with examples of good reasons for breaking the guidelines. Microsoft architects Krzysztof Cwalina and Brad Abrams offer guidelines for framework design from the top down. From their long experience and deep insight, you will learn The general philosophy of framework design Principles and guidelines that are fundamental to overall framework design Naming guidelines for the various parts of a framework, such as namespaces, types, and members Guidelines for the design of types and members of types Issues and guidelines that are important to ensure appropriate extensibilityin your framework Guidelines for working with exceptions, the preferred error reporting mechanism in the .NET Framework and WinFX Guidelines for extending and using types that commonly appear in frameworks Guidelines for and examples of common framework design patterns Guidelines in this book come in four major forms:Do,Consider,Avoid, andDo not. In general, aDoguideline should almost always be followed, aConsiderguideline should generally be followed, anAvoidguideline indicates that something is generally not a good idea, and aDo notguideline indicates something you should almost never do. Every guideline includes a discussion of its applicability, and most guidelines include a code example. A companion DVD includes theDesigning .NET Class Librariesvideo series, instructional presentations by the authors on design guidelines for developing classes and components that extend the .NET Framework. A sample API specification and other useful resources are also included.

More on Amazon.com

RESTful Web Services

Leonard Richardson, Sam Ruby

Shows how to use the REST architectural style to create web sites that can be used by computers as well as machines, providing basic rules for using REST and real-life examples of such Web services.

More on Amazon.com

Dependency Injection in .NET

Mark Seemann

"Dependency Injection in .NET" is a comprehensive guide that introduces DI to .NET developers. It covers core concepts and patterns, and introduces important DI frameworks, such as StructureMap, Windsor, and Spring.NET.

More on Amazon.com

Enterprise Integration Patterns

Gregor Hohpe, Bobby Woolf

Would you like to use a consistent visual notation for drawing integration solutions? "Look inside the front cover." Do you want to harness the power of asynchronous systems without getting caught in the pitfalls? "See "Thinking Asynchronously" in the Introduction." Do you want to know which style of application integration is best for your purposes? "See Chapter 2, Integration Styles." Do you want to learn techniques for processing messages concurrently? "See Chapter 10, Competing Consumers and Message Dispatcher." Do you want to learn how you can track asynchronous messages as they flow across distributed systems? "See Chapter 11, Message History and Message Store." Do you want to understand how a system designed using integration patterns can be implemented using Java Web services, .NET message queuing, and a TIBCO-based publish-subscribe architecture? "See Chapter 9, Interlude: Composed Messaging." Utilizing years of practical experience, seasoned experts Gregor Hohpe and Bobby Woolf show how asynchronous messaging has proven to be the best strategy for enterprise integration success. However, building and deploying messaging solutions presents a number of problems for developers. " Enterprise Integration Patterns " provides an invaluable catalog of sixty-five patterns, with real-world solutions that demonstrate the formidable of messaging and help you to design effective messaging solutions for your enterprise. The authors also include examples covering a variety of different integration technologies, such as JMS, MSMQ, TIBCO ActiveEnterprise, Microsoft BizTalk, SOAP, and XSL. A case study describing a bond trading system illustrates the patterns in practice, and the book offers a look at emerging standards, as well as insights into what the future of enterprise integration might hold. This book provides a consistent vocabulary and visual notation framework to describe large-scale integration solutions across many technologies. It also explores in detail the advantages and limitations of asynchronous messaging architectures. The authors present practical advice on designing code that connects an application to a messaging system, and provide extensive information to help you determine when to send a message, how to route it to the proper destination, and how to monitor the health of a messaging system. If you want to know how to manage, monitor, and maintain a messaging system once it is in use, get this book. 0321200683B09122003

More on Amazon.com

Learning WCF

Michele Bustamante

Provides information and examples on using Windows Communication Foundation to build service-oriented applications.

More on Amazon.com

Implementing Domain-Driven Design

Vaughn Vernon

“For software developers of all experience levels looking to improve their results, and design and implement domain-driven enterprise applications consistently with the best current state of professional practice, Implementing Domain-Driven Design will impart a treasure trove of knowledge hard won within the DDD and enterprise application architecture communities over the last couple decades.” –Randy Stafford, Architect At-Large, Oracle Coherence Product Development “This book is a must-read for anybody looking to put DDD into practice.” –Udi Dahan, Founder of NServiceBus Implementing Domain-Driven Design presents a top-down approach to understanding domain-driven design (DDD) in a way that fluently connects strategic patterns to fundamental tactical programming tools. Vaughn Vernon couples guided approaches to implementation with modern architectures, highlighting the importance and value of focusing on the business domain while balancing technical considerations. Building on Eric Evans' seminal book, Domain-Driven Design, the author presents practical DDD techniques through examples from familiar domains. Each principle is backed up by realistic Java examples–all applicable to C# developers–and all content is tied together by a single case study: the delivery of a large-scale Scrum-based SaaS system for a multitenant environment. The author takes you far beyond “DDD-lite” approaches that embrace DDD solely as a technical toolset, and shows you how to fully leverage DDD's “strategic design patterns” using Bounded Context, Context Maps, and the Ubiquitous Language. Using these techniques and examples, you can reduce time to market and improve quality, as you build software that is more flexible, more scalable, and more tightly aligned to business goals. Coverage includes Getting started the right way with DDD, so you can rapidly gain value from it Using DDD within diverse architectures, including Hexagonal, SOA, REST, CQRS, Event-Driven, and Fabric/Grid-Based Appropriately designing and applying Entities–and learning when to use Value Objects instead Mastering DDD's powerful new Domain Events technique Designing Repositories for ORM, NoSQL, and other databases

More on Amazon.com

Programming WCF Services

Juval Lowy

Provides information on developing service-oriented applications for Windows.

More on Amazon.com

The Data Model Resource Book

Len Silverston

A quick and reliable way to build proven databases for core business functions Industry experts raved about The Data Model Resource Book when it was first published in March 1997 because it provided a simple, cost-effective way to design databases for core business functions. Len Silverston has now revised and updated the hugely successful First Edition, while adding a companion volume to take care of more specific requirements of different businesses. Each volume is accompanied by a CD-ROM, which is sold separately. Each CD-ROM provides powerful design templates discussed in the books in a ready-to-use electronic format, allowing companies and individuals to develop the databases they need at a fraction of the cost and a third of the time it would take to build them from scratch. Updating the data models from the First Edition CD-ROM, this resource allows database developers to quickly load a core set of data models and customize them to support a wide range of business functions.

More on Amazon.com

Pro C# 2008 and the .NET 3.5 Platform

Andrew Troelsen

.NET 3.5 is Microsoft’s largest development software launch since .NET 2.0 and (unlike .NET 3.0) completely replaces all previous .NET versions. A new version of Visual Studio – Visual Studio ‘Orcas’ is being created for the new Framework together with new versions of both the C# and Visual Basic languages. This book deals with this new C# language and provides developers with a complete treatise on the new technology – explaining the importance of all the new features (lambda expressions, LINQ, ASP.NET AJAX, WPF everywhere) and how they integrate into the framework of the previous .NET versions. It is a comprehensively revised and updated version of the author’s previous award-winning titles.

More on Amazon.com

Head First Servlets and JSP

Bryan Basham, Kathy Sierra, Bert Bates

This book gets readers up to speed on the technology necessary to write servlets and JSPs, what makes the Container tick, how to use the new JSP Expression Language (EL), how to write deployment descriptors, and even how to use some server-side design patterns.

More on Amazon.com

REST in Practice

Jim Webber, Savas Parastatidis, Ian Robinson

REST continues to gain momentum as the best method for building web services, leaving many web architects to consider whether and how to include this approach in their SOA and SOAP-dominated world. This book offers a down-to-earth explanation of REST, with techniques and examples that show you how to design and implement integration solutions using the REST architectural style. Explore several web communications approaches, and discover what makes REST different Walk through the pros and cons of the RESTful approach Learn how the underlying architecture of the Web can drastically simplify programming built on top of it View REST in the context of cloud computing and the Semantic Web Understand how hypermedia serves as a model for computers to process data

More on Amazon.com

Building Scalable Web Sites

Cal Henderson

A guide to developing Web sites using scalable applications.

More on Amazon.com

Beginning iPhone 3 Development

David Mark, Jeff LaMarche

Are you a programmer looking for a new challenge? Does the thought of building your very own iPhone app make your heart race and your pulse quicken? If so, Beginning iPhone 3 Development: Exploring the iPhone SDK is just the book for you. Updated and revised for iPhone SDK 3, many of the discussions in the original book have been clarified to make some of the more complex topics easier to understand. In addition, all of the projects have been rebuilt from scratch using the SDK 3 templates. Assuming only a minimal working knowledge of Objective-C, and written in a friendly, easy-to-follow style, this book offers a complete soup-to-nuts course in iPhone and iPod touch programming. The book starts with the basics, walking you through the process of downloading and installing Apple's free iPhone SDK, and then stepping you though the creation of your first simple iPhone application. From there, you'll learn to integrate all the interface elements iPhone users have come to know and love, such as buttons, switches, pickers, toolbars, and sliders. You'll master a variety of design patterns, from the simplest single view to complex hierarchical drill-downs. The confusing art of table building will be demystified, and you'll see how to save your data using the iPhone file system. You'll also learn how to save and retrieve your data using SQLite, iPhone's built-in database management system. In addition, you'll also learn about Core Data, an important persistence mechanism that has just been added with SDK 3. And there's much more! You'll learn to draw using Quartz 2D and OpenGL ES, add multitouch gestural support (pinches and swipes) to your applications, and work with the camera, photo library, accelerometer, and built-in GPS. You'll discover the fine points of application preferences and learn how to localize your apps for multiple languages. You can discover more about this book, download source code, and find support forums at the book's companion site, at www.iphonedevbook.com. The iPhone 3 update to the best-selling and most recommended book for iPhone developers Packed full of tricks, techniques, and enthusiasm for the new SDK from a developer perspective The most complete, useful, and up-to-date guide to all things having to do with Apple's iPhone SDK What you’ll learn Everything you need to know to develop your own best-selling iPhone apps Best practices for optimizing your code and delivering great user experiences Who this book is for Anyone who wants to start developing for iPhone and iPod touch What's changed from the first edition of Beginning iPhone Development All code samples have been updated to follow current Apple coding conventions The autorotation code has been updated to use the new single-step fast autorotation instead of the original two-step method A new section has been added introducing Core Data, covering basic principles and showing how to build a simple Core Data application All the table view-related chapters have been updated to use table view cell styles. They've also been updated to use textLabel and detailTextLabel instead of the deprecated text property of the table view cell. All known errata have been corrected All projects have been rebuilt from scratch using the SDK 3.0 templates Many concepts have been clarified based on feedback and supplemented with information we've learned from another year of using the SDK Table of Contents Welcome to the Jungle Appeasing the Tiki Gods Handling Basic Interaction More User Interface Fun Autorotation and Autosizing Multiview Applications Tab Bars and Pickers Introduction to Table Views Navigation Controllers and Table Views Application Settings and User Defaults Basic Data Persistence Drawing with Quartz and OpenGL Taps, Touches, and Gestures Where Am I? Finding Your Way with Core Location Whee! Accelerometer! iPhone Camera and Photo Library Application Localization Where to Next?

More on Amazon.com

Spring in Action

Craig Walls, Ryan Breidenbach

A guide to the Spring Framework provides instructions for designing and building applications.

More on Amazon.com

RESTful Web Services Cookbook

Subbu Allamaraju

Provides information on designing RESTful Web services for client and server applications, covering such topics as Web linking, content negotiation, Web caching, queries, security, and compatibility.

More on Amazon.com

SSL and TLS

Eric Rescorla

""This is the best book on SSL/TLS. Rescorla knows SSL/TLS as well as anyone and presents it both clearly and completely.... At times, I felt like he's been looking over my shoulder when I designed SSL v3. If network security matters to you, buy this book."" Paul Kocher, Cryptography Research, Inc. Co-Designer of SSL v3 " "Having the right crypto is necessary but not sufficient to having secure communications. If you're using SSL/TLS, you should have "SSL and TLS"sitting on your shelf right next to "Applied Cryptography." Bruce Schneier, Counterpane Internet Security, Inc. Author of "Applied Cryptography"" "Everything you wanted to know about SSL/TLS in one place. It covers the protocols down to the level of packet traces. It covers how to write software that uses SSL/TLS. And it contrasts SSL with other approaches. All this while being technically sound and readable!"" Radia Perlman, Sun Microsystems, Inc. Author of "Interconnections" Secure Sockets Layer (SSL) and its IETF successor, Transport Layer Security (TLS), are the leading Internet security protocols, providing security for e-commerce, web services, and many other network functions. Using SSL/TLS effectively requires a firm grasp of its role in network communications, its security properties, and its performance characteristics. "SSL and TLS" provides total coverage of the protocols from the bits on the wire up to application programming. This comprehensive book not only describes how SSL/TLS is supposed to behave but also uses the author's free ssldump diagnostic tool to show the protocols in action. The author covers each protocol feature, first explaining how it works and then illustrating it in a live implementation. This unique presentation bridges the difficult gap between specification and implementation that is a common source of confusion and incompatibility. In addition to describing the protocols, "SSL and TLS" delivers the essential details required by security architects, application designers, and software engineers. Use the practical design rules in this book to quickly design fast and secure systems using SSL/TLS. These design rules are illustrated with chapters covering the new IETF standards for HTTP and SMTP over TLS. Written by an experienced SSL implementor, "SSL and TLS" contains detailed information on programming SSL applications. The author discusses the common problems faced by implementors and provides complete sample programs illustrating the solutions in both C and Java. The sample programs use the free OpenSSL and PureTLS toolkits so the reader can immediately run the examples. 0201615983B04062001

More on Amazon.com

The Art of Capacity Planning

John Allspaw

Success on the web is measured by usage and growth. Web-based companies live or die by the ability to scale their infrastructure to accommodate increasing demand. This book is a hands-on and practical guide to planning for such growth, with many techniques and considerations to help you plan, deploy, and manage web application infrastructure. The Art of Capacity Planning is written by the manager of data operations for the world-famous photo-sharing site Flickr.com, now owned by Yahoo! John Allspaw combines personal anecdotes from many phases of Flickr's growth with insights from his colleagues in many other industries to give you solid guidelines for measuring your growth, predicting trends, and making cost-effective preparations. Topics include: Evaluating tools for measurement and deployment Capacity analysis and prediction for storage, database, and application servers Designing architectures to easily add and measure capacity Handling sudden spikes Predicting exponential and explosive growth How cloud services such as EC2 can fit into a capacity strategy In this book, Allspaw draws on years of valuable experience, starting from the days when Flickr was relatively small and had to deal with the typical growth pains and cost/performance trade-offs of a typical company with a Web presence. The advice he offers in The Art of Capacity Planning will not only help you prepare for explosive growth, it will save you tons of grief.

More on Amazon.com

Beginning ASP.NET Security

Barry Dorrans

Programmers: protect and defend your Web apps against attack! You may know ASP.NET, but if you don't understand how to secure your applications, you need this book. This vital guide explores the often-overlooked topic of teaching programmers how to design ASP.NET Web applications so as to prevent online thefts and security breaches. You'll start with a thorough look at ASP.NET 3.5 basics and see happens when you don't implement security, including some amazing examples. The book then delves into the development of a Web application, walking you through the vulnerable points at every phase. Learn to factor security in from the ground up, discover a wealth of tips and industry best practices, and explore code libraries and more resources provided by Microsoft and others. Shows you step by step how to implement the very latest security techniques Reveals the secrets of secret-keeping—encryption, hashing, and not leaking information to begin with Delves into authentication, authorizing, and securing sessions Explains how to secure Web servers and Web services, including WCF and ASMX Walks you through threat modeling, so you can anticipate problems Offers best practices, techniques, and industry trends you can put to use right away Defend and secure your ASP.NET 3.5 framework Web sites with this must-have guide.

More on Amazon.com

Test-driven IOS Development

Graham Lee

As iOS apps become increasingly complex and business-critical, iOS developers must ensure consistently superior code quality. This means adopting best practices for creating and testing iOS apps. Test-Driven Development (TDD) is one of the most powerful of these best practices. Test-Driven iOS Development is the first book 100% focused on helping you successfully implement TDD and unit testing in an iOS environment. Long-time iOS/Mac developer Graham Lee helps you rapidly integrate TDD into your existing processes using Apple's Xcode 4 and the OCUnit unit testing framework. He guides you through constructing an entire Objective-C iOS app in a test-driven manner, from initial specification to functional product. Lee also introduces powerful patterns for applying TDD in iOS development, and previews powerful automated testing capabilities that will soon arrive on the iOS platform. Coverage includes Understanding the purpose, benefits, and costs of unit testing in iOS environments Mastering the principles of TDD, and applying them in areas from app design to refactoring Writing usable, readable, and repeatable iOS unit tests Using OCUnit to set up your Xcode project for TDD Using domain analysis to identify the classes and interactions your app needs, and designing it accordingly Considering third-party tools for iOS unit testing Building networking code in a test-driven manner Automating testing of view controller code that interacts with users Designing to interfaces, not implementations Testing concurrent code that typically runs in the background Applying TDD to existing apps Preparing for Behavior Driven Development (BDD) The only iOS-specific guide to TDD and unit testing, Test-Driven iOS Development covers both essential concepts and practical implementation.

More on Amazon.com

Enterprise Service Bus

David Chappell

Large IT organizations increasingly face the challenge of integrating various web services, applications, and other technologies into a single network. The solution to finding a meaningful large-scale architecture that is capable of spanning a global enterprise appears to have been met in ESB, or Enterprise Service Bus. Rather than conform to the hub-and-spoke architecture of traditional enterprise application integration products, ESB provides a highly distributed approach to integration, with unique capabilities that allow individual departments or business units to build out their integration projects in incremental, digestible chunks, maintaining their own local control and autonomy, while still being able to connect together each integration project into a larger, more global integration fabric, or grid. Enterprise Service Bus offers a thorough introduction and overview for systems architects, system integrators, technical project leads, and CTO/CIO level managers who need to understand, assess, and evaluate this new approach. Written by Dave Chappell, one of the best known and authoritative voices in the field of enterprise middleware and standards-based integration, the book drills down into the technical details of the major components of ESB, showing how it can utilize an event-driven SOA to bring a variety of enterprise applications and services built on J2EE, .NET, C/C++, and other legacy environments into the reach of the everyday IT professional. With Enterprise Service Bus, readers become well versed in the problems faced by IT organizations today, gaining an understanding of how current technology deficiencies impact business issues. Through the study of real-world use cases and integration patterns drawn from several industries using ESB--including Telcos, financial services, retail, B2B exchanges, energy, manufacturing, and more--the book clearly and coherently outlines the benefits of moving toward this integration strategy. The book also compares ESB to other integration architectures, contrasting their inherent strengths and limitations. If you are charged with understanding, assessing, or implementing an integration architecture, Enterprise Service Bus will provide the straightforward information you need to draw your conclusions about this important disruptive technology.

More on Amazon.com

Professional XMPP Programming with JavaScript and JQuery

Jack Moffitt

Provides information on using XMPP to build applications or add new features to current applications, covering such topics as the debugging console, the identica client, service discovery, event handling, and plugins.

More on Amazon.com

SOA Using Java Web Services

Mark D. Hansen

The comprehensive tutorial to solving Enterprise Application Integration (EAI) problems using Web services and Java.

More on Amazon.com

Joel on Software

Joel Spolsky

Joel Spolsky began his legendary web log, www.joelonsoftware.com, in March 2000, in order to offer insights for improving the world of programming. Spolsky based these observations on years of personal experience. The result just a handful of years later? Spolsky's technical knowledge, caustic wit, and extraordinary writing skills have earned him status as a programming guru! His blog has become renowned throughout the programming worldnow linked to more than 600 websites and translated into over 30 languages. Joel on Software covers every conceivable aspect of software programming—from the best way to write code, to the best way to design an office in which to write code! All programmers, all people who want to enhance their knowledge of programmers, and all who are trying to manage programmers will surely relate to Joel's musings. Table of Contents Choosing a Language Back to Basics The Joel Test: 12 Steps to Better Code The Absolute Minimum Every Software Developer Absolutely, Positively Must Know About Unicode and Character Sets (No Excuses!) Painless Functional Specifications Part 1: Why Bother? Painless Functional Specifications Part 2: What’s a Spec? Painless Functional Specifications Part 3: But . . . How? Painless Functional Specifications Part 4: Tips Painless Software Schedules Daily Builds Are Your Friend Hard-Assed Bug Fixin’ Five Worlds Paper Prototyping Don’t Let Architecture Astronauts Scare You Fire and Motion Craftsmanship Three Wrong Ideas from Computer Science Biculturalism Get Crash Reports From Users—Automatically! The Guerilla Guide to Interviewing Incentive Pay Considered Harmful Top Five (Wrong) Reasons You Don’t Have Testers Human Task Switches Considered Harmful Things You Should Never Do, Part One The Iceberg Secret, Revealed The Law of Leaky Abstractions Lord Palmerston on Programming Measurement Rick Chapman Is In Search of Stupidity What Is the Work of Dogs in This Country? Getting Things Done When You’re Only a Grunt Two Stories Big Macs vs. The Naked Chef Nothing Is As Simple As It Seems In Defense of Not-Invented-Here Syndrome Strategy Letter I: Ben & Jerry’s vs. Amazon Strategy Letter II: Chicken-and-Egg Problems Strategy Letter III: Let Me Go Back! Strategy Letter IV: Bloatware and the 80/20 Myth Strategy Letter V: The Economics of Open Source A Week of Murphy’s Law Gone Wild How Microsoft Lost the API War Microsoft Goes Bonkers Our .NET Strategy Please Sir May I Have a Linker?

More on Amazon.com

The Data WarehouseETL Toolkit

Ralph Kimball, Joe Caserta

Cowritten by Ralph Kimball, the world's leading data warehousing authority, whose previous books have sold more than 150,000 copies Delivers real-world solutions for the most time- and labor-intensive portion of data warehousing-data staging, or the extract, transform, load (ETL) process Delineates best practices for extracting data from scattered sources, removing redundant and inaccurate data, transforming the remaining data into correctly formatted data structures, and then loading the end product into the data warehouse Offers proven time-saving ETL techniques, comprehensive guidance on building dimensional structures, and crucial advice on ensuring data quality

More on Amazon.com

javac#c++c.netalgorithmphppythonjavascriptdesignasp.netlanguage-agnosticdesign-patternsandroidoopsqllinuxdatabasematharchitectureperformanceprogramming-languagesresourcesuser-interfacemysqlhtmlsql-serverwindowsiphonerubyiosmultithreadingdata-structuresresearchobjective-csecuritycomputer-scienceassemblyruby-on-railsjquerydatabase-designdocumentationasp.net-mvcunit-testingrcompiler-constructiontestingunixcsssoftware-engineeringwpfartificial-intelligenceweb-applicationsvb.netreferenceclassvisual-studioweb-servicesoptimizationarraysnetworkingproject-managementjava-eeumleclipseosxcoding-styleagilegraphicswinformsoperating-systemmemory-managementoracleembeddedspringwinapivisual-c++image-processingmodel-view-controllerajaxhardwareparsingfunctional-programmingregexamazonmemorytddtheoryinheritancefunction3dstatisticsperlopenglkernelopen-sourcexcodeapistringnlpxmlcocoawcfentity-frameworkdebuggingmachine-learninginterfacerefactoringactionscript-3concurrencymatlabrestdomain-driven-designdelphic#-4.0stlgraphpointersnode.jsscriptingopengl-estemplatessharepointidelispsilverlightdjangoprocessparallel-processingamazon-web-servicesuntaggedcommand-linex86scalasocketssql-server-2008visual-studio-2008frameworkshtml5audioobjectlistneural-networkproject-planningvb6visual-studio-2010flexswinglinux-kernelstandardslogicproductivitysearchencryptionc++11mobilec++-faqqtscrumgccscalabilityf#genericsmfcflashhaskelltsqlsortingsoftware-designversion-controllinqsql-server-2005treeweb-scrapingterminologyimagemethodologyasynchronousvbaxamlvariablesshellasp.net-mvc-3boostexcelooadopencvusbcryptographyc#-3.0eventsphysicstypesapachepluginsnetwork-programminghibernatetcpclojurematrixsyntaxmethodsssasrecursionsignal-processinggeometrycachingfortranpostgresqlcocoa-touchdependency-injectionschemestackipadgame-enginefileclass-designauthenticationinterpreterdeploymentarduinomodelruby-on-rails-32djsondirectxbluetoothfrontendusabilityspring-mvccomputer-visionformslambdasoawebinternalscollectionslinux-device-driverfilesystemsejbexceptionnhibernatevectorqadllcomlanguage-design.net-3.5linq-to-sqlvideogarbage-collectionhttpembedded-linuxjvmsqlitenaming-conventionssystembashimplementationmvvmtimezend-frameworkwebsitebddjspdata-access-layerthread-safetyscientific-computingvalidationindexingjunitosdevmockingopensslconstructorgrailsuser-experiencexpathreal-timerelational-databasecompilationmodelingtextmongodbdata-modelingormextreme-programmingprotocolsdevelopment-environmentprojectwebformsanalysisposixlow-levelclient-serversingletonservletsdata-miningsynchronizationclrcomparisonlanguage-featuresamazon-product-apimonocommon-lispmicrocontrollercontinuous-integrationhadoopxnacomplexity-theoryasp.net-mvc-4diagramcudasimulationencapsulationrandomhyperlinkdommacrosmusicshaderprojectsgwtjoinms-accesse-commercelinked-listwindows-phone-7linkerbinarydictionarystaticanti-patternscontent-management-systempolymorphismloopsstructurevisualizationstructactionscriptjpasvndata-warehouseabstract-classgroovyclosurescss3distributedprologtfsexception-handlinganimationdynamic-programmingdiscrete-mathematicssocial-networkingiorepository-patternif-statementcpuhashautomated-testssslkeyboardcode-reviewdynamicmetaprogrammingseleniumeclipse-pluginestimationheapgenetic-algorithmcode-generationlockingclassificationolapdrupalroboticsreverse-engineeringspecificationscomputational-geometryazurenormalizationmemory-leaksdriverssisopenclprofilingopengl-es-2.0grammarraspberry-picastingjava-meelectronicsmsbuildpthreadsarmxhtmlscreen-scrapingpropertiescanvastomcatuser-interactionrenderingpython-3.xstored-proceduresinputnullandroid-ndknosql.net-4.0scopeplsqlhistorydevice-drivervhdlios5pattern-matchingmessagingrequirementscommentscpu-architectureubuntujsfcommunicationasp.net-ajaxnunitipcinversion-of-controldesign-principlesclouderlangdefinitionworkflown-tierxsltnamespacesmoduleblogssolid-principlessharepoint-2010gitgpudelegatesextjsdatasetlayoutsoaphigh-availabilityfftmakefileintegration-testingparameterscomputer-architecturenetbeansswiftruntimereporting-servicesquery-optimizationlegacygoogle-app-engineios4windows-7pocograph-theorydsltransactionsasp-classicautomationconfigurationsharepoint-2007workflow-foundationuse-caseinitializationfacebookreflectionbuttoniteratorado.netbig-odata-visualizationtimerbuildfull-text-searchactiverecordoperator-overloadingandroid-layoutcallbackjnibit-manipulationsymbianturing-machinesx86-64csvangularjsmigrationsdkconventionsexcel-vbajavafxtext-miningserializationerror-handlingbusiness-intelligenceannotationsbiztalkaopssl-certificatecucumberappleidiomaticmutexocamlcoldfusionrotationfinancebuild-processcore-dataincludedesktopfor-loopformal-verificationkinectbluetooth-lowenergyvimmapgpgpuwindbgasp.net-2.0constants.net-2.0global-variablesmultiple-inheritanceiisdownloadsrpentityreportingeditorknapsack-problemprocessordatetimemavenjbossswitch-statementcode-organizationchartsmallocbisonpkiimmutabilityloggingsoftware-qualityenumsmipsfirmwarecode-coverageserial-portseparation-of-concernscodeigniteralgebraintegrationc++-clischedulingmetricsoperatorsglassfishrspeccompressionxcode4procedural-programmingpdfcameraosgientity-framework-4.1printfcode-metricsyacclicensingfinite-automatafile-ioserviceopengl-3mdxhtml-parsingload-balancingtime-complexitycross-platformurlsignalspersistencelexwindows-8verilogunicodereadabilityportingnew-operatorwolfram-mathematicagame-physicsmapreducemulticorewhile-loopc#-2.0vm-implementationcakephprsavisual-studio-2005nestedc99colorsgdbbinary-treenamingbuild-automationcocos2d-iphonepython-2.7asp.net-mvc-2floating-pointoverloadinginternationalizationcilinformation-extractioncompiler-theorybrowserpowershellconstforeign-keysjsf-2time-managementmessage-queuehciblackberrynetwork-protocolsglslencodingsaasopengl-4uitableviewudpilgembsdmultidimensional-arraystatic-methodswebglidiomscertificateaesioc-containerrtoslocalizationadaptercurlbeautifulsoupintegermanualtask-parallel-librarystreamclient-sidelatextaskswtautomataphpunitmoqatomicejb-3.0expression-blenddnsclientawtreviewsql-server-2012terminalpseudocodelinear-algebrapass-by-referencecontact-formcqrsweb-crawlercode-smellstrategy-patternexpressstatedriverspublic-key-encryptionvisual-studio-2013prototypeevolutionary-algorithmbackbone.jsspeech-recognitiondrawingosx-snow-leoparduser-controlssemantic-webselectentity-framework-4booleanpermissionsbioinformaticspsychologyvisual-studio-2012heuristicsrdbmslucenesteganographyjsoupaugmented-realityinterruptpair-programmingcallscrapecompact-frameworkbindingtime-seriesinteropdata-accessglutraytracingdependenciesfactorydevicewarningstemporal-databaseseoreturn-valuedevelopment-processnumbersfactory-patterndistributed-computingsmltransitionjdbcjerseytext-editorlaravelbusiness-logicsessionpattern-recognitionfiltersystem-callscontrollerthreadpooloutlooksql-server-2000jitsetasp.net-web-apiwordpresscdimemcachedbytecodestate-machinesbitmapunity3dmathematical-optimizationrmibrancharraylistopenmpcomponentsconditionalsicpluagame-theorythisocrbiztalk-2010jquery-mobileevent-handlingactivexsyncarchitectural-patternsxsdsynthesispathatlnumerical64bitcode-snippetsassertbinary-search-treeinsertrazorsasjoomlanfcinternalxunitcoordinatesemacsui-designcompiler-errorssamplevirusdatamodelteamworksystems-programmingjiracontext-free-grammarawkstdschemadatehttpssolrgraphic-designandroid-activityvirtual-memoryauthorizationgrepsmart-pointersesbcopybatch-fileiterationvirtual-functionsasync-awaitninjectconditional-statementscgiprimitivefunctorrelease-managementrequestapi-designstatic-analysisassertionsphotoshopstylesorderdatabase-schemaactordiscoveryabstractionwindows-cebuffereclipse-rcpmvpbuffer-overflowantoracle11gdatabase-connection.net-3.0windows-mobileclass-diagramtraitsrssquartz-graphicscvsshopping-cartbigdatamvvm-lightfpgaroutingef-code-firstphysics-enginegdicobolprobabilitytelecommunicationsegmentation-faultsharepoint-brandingtimeoutwebsocketsemaphoredaemonjava-ee-6akkacrashhashmapmysqliobserver-patterndsl-toolscapacity-planningdesktop-applicationwindows-xpiis-7batterysql-server-2008-r2attributesmetadatacluster-analysisevent-drivencompile-timedifferential-equationssql-injectionprojects-and-solutionsexploitversioningdaohashtablegnuobject-oriented-analysisload-testinglambda-calculusidisposablerdfmongrelcollision-detectionportsymfony2consolefault-toleranceggplot2jpegc++14performancepointviewcompiler-developmentgraph-algorithmyiiregressionargumentstfs2010qt4loginwtlpublish-subscribemodularityimportmontecarlomousequeuekernel-modulesearch-enginelock-freecode-analysisreference-manualprotectedcustom-controlsinstanceguidcontrolsrepositorycompiler-optimizationrestful-architecturecsprojstrutsmonodevelopcalculatormiddlewarefuzzy-logicdojodatabase-performancerunnabledrupal-7business-logic-layercode-contractsprintingxamarin.iosxpagesnativeshared-memorysharepoint-designerautomated-refactoringmudtry-catchwcf-data-servicesequationpygamekr-cbinary-searcht4smalltalkrelationalwirelesss4race-conditionpackage-designbenchmarkingcharacter-encodingheader-filesasp.net-mvc-routingdatamapperinline-assemblydoubleheaderlanguage-theorylabviewanalyticsdata-analysisvisual-sourcesafemarkovtranslationtypedefstack-overflowcore-animationjmsdirectoryundefined-behaviorvalue-typesynchronizedlucene.netlegacy-codecpu-registersfsmmpifunctional-testingarticlelibrariesdata-bindingoracle10grecommendation-enginesencha-touchapplyuikithidden-markov-modelsgocore-bluetoothfreebsdextensibilityprimary-keymlrcpdisposeresharpersdlcforkneo4jsimple-html-domworkflow-foundation-4rich-internet-applicationcode-access-securityhalting-problembibliographyunity-containerpaginghashcodescreendcomwixp2ptokenddd-repositorieskeyboard-shortcutscordovajavascript-eventselfbug-trackingscjpwindows-servicesapp-storecore-graphicsflaskmonitoringresponsive-designffmpegqt-creatorbigintegercompositionjava-7denormalizationasmxconventionlayersiliconbpmc-preprocessorreturn-typevb6-migrationlinq-to-xmlnumerical-methodsformattingplayframeworkapplication-planningentity-attribute-valuepriority-queueironrubytestcasesymbolspredictionredminemaintenancecomputation-theoryprojectionmaintainabilityforms-authenticationdatabase-partitioningpuzzleobfuscationbehaviorms-wordwebcamred-black-treetwittercommand-line-interfacedomain-modelinformation-retrievalimage-manipulationgenetic-programmingxquerymany-to-manyui-guidelinesreleasevideo-streamingc++-standard-libraryassignment-operatorergonomicslinq-to-entitiesosx-leoparddrycontainersmockitohidden-featureslexical-analysisadvertisingviewssnmpequalsejb-3.1oltprolesjunit4kinect-sdkrhino-mocksdirectx-11identitydisassemblingwinsockcfmlequalityaccelerometern-tier-architectureglobalizationtfsbuildsemanticsprivateui-patternsorganizationaggregationgetsizeprototypal-inheritancecalendarreplacemyeclipsepermutationnantscripting-languageactive-directoryvstoruby-on-rails-4function-pointersdesign-timelazy-evaluationperformance-testingwindows-phoneconstraintsstress-testingwebviewbnfserver-sideruby-on-rails-pluginssql-server-expressgoogle-chrometagssilverlight-4.0flex4.5packetiostreamprecisiontwistedhierarchical-datainformixmobile-websitesinatrainferencewaitb-treedumpallocatorpersonal-software-processaccessibilitymixinsshared-ptrantlrspatialflex4pipescalingtriggersgethashcodeassociative-arrayenterprisesystem-designcontinuous-deliverygrizzlypaypalcmdappceleratorscrapycouplinglistboxvisual-studio-2015passwordsamazon-ec2nonblockingfreenutchfuturecruisecontrol.netsyntax-errorbayesianimage-recognitionansi-sqlsvmpreprocessorfractalsdeadlockethernetfatbytecpu-cachescipyoverflownamed-entity-recognitionutf-8cassandraparser-generatorechokindle-fireformal-languagesspectrumienumerabledomainservicesmessagedynamics-crmrulescounthigher-order-functionssubstringmasmnotationblockingunions2d-gamesvocabularyraspbianfibonacciadalexercapybaraoracle-adfagile-processeskey-bindingsnservicebustornadoentity-framework-5simdfontsinner-classeswindows-ntregular-languageimperative-programmingthree.jsvideo-game-consolessmartphonedatagridviewreportflash-cs3hashsetsseusingastronomyface-recognitiongettercastle-windsorinterrupt-handlingcode-formattingerbcritical-sectiongetter-setterldapprivate-membersmapsaggregatenumerical-analysisgradleintlow-latencymoduloxlibdirected-acyclic-graphsconnectionvoting-systemjava-2dtclbootloaderstring-matchinginterpreted-languagetkinteramazon-mwsteamsystemciderweb-apierddeliverywmikeywordxmppramgeneratordtowcf-securitypokerbindflex-lexercore-audioprototypejsfriendplatformlinguisticsframebufferexpressionnamed-pipestablestublanguage-lawyerlinear-programmingshared-librariespackageoverridedistanceexerestful-authenticationpojolocalwindows-installernavigationhbasegoogle-chrome-extensionincrementxunit.netviewstategrand-central-dispatchiocpcontinuous-deploymentchildrenhangselenium-webdrivermobile-phonesmaven-2uiviewxssdirect3dfortran90csladuplicatessumpublic-methodwindows-store-appsproofyuiredmine-pluginsvirtualizationwindowvoicesingle-sign-onsql-azureiphone-sdk-3.0phpmyadmindrupal-6asymptotic-complexitygpsnormalizingregistrycodebasehostingcrash-dumpsremotingfinalizernotificationsperforceglobalexecutablesubclassconways-game-of-liferaiidatacontextbotspostindentationtext-processingtaocpcorrelationalsahookcubessednasmreplicationdfalocalereactjsvariable-assignmentdynamic-languageshuman-computer-interfaceinformation-theoryracketversionsvideo-capturetemplate-meta-programmingfactory-methodcode-injectionhdmiasp.net-membershipoctaveplotapplescriptwifibit-shiftcom-interopmainframeetlprototype-patterncollisioncellular-automatahierarchyansiprimitive-typesbitwikiscanfstylesheetmarkov-chainsmountenumerationcode-duplicationfieldbackgroundasp.net-3.5debianequivalencemenuemgucvode.net-assemblydrupal-modulespaginationlarge-datatemplate-specializationpredicatejenacallstackloaderpreg-replacechessrewritejax-wscmakefluent-interfacereliabilitygeospatialself-hostingvirtual-address-spacethree-tierbitvectordiagrammingowlkindlemulti-tenantjoglhidwebpagesettermedia-queriesgoogle-glassgeographymedicalclassloadermultiplayermd5generic-programmingeffective-c++distributed-systemexecforeachnoiseshellcodeobd-iivalue-objectshdlpddlcrc32emailtext-analysisruby-on-rails-3.2xslt-1.0compositenvidiatail-call-optimizationsolarisgroupingparentheseswicketipv4sipclipscategory-theorymstestminimizationgsmwindows-vistafopasp.net-4.0programming-paradigmsrubygemsmanaged-directxequinoxlensdijkstrajpa-2.0memory-addressrakecoffeescriptzoomwiresharkgdcompiler-warningsaccess-specifierdependency-propertiestarget-frameworkjquery-pluginswekamemory-barriersmetalandroid-emulatorautomakeopencvdotnetdreamweavervisitoradobefirefoxinstallationtelnetdeprecatedcomposite-componentgoogle-apirestletkernighan-and-ritchieflex3wifclickliteralsclangdosnameslanguage-constructcometstylecopsimulated-annealinghandwritingmicroservicesroutessvgfacebook-fqlembedn-gramroundingforecastingtransformline-of-business-apptooltippromisemarkupdecimalgalleryredundancycompareusing-statementdocx509loadallocationreinforcement-learninggdi+fluid-dynamicspointtuplesabstract-syntax-treesysadminweb-standardsjvm-languagestic-tac-toerankingisolation-levelacidnltk6502midiuser-storiesubuntu-9.04birtdashboardfile-uploadphotosustainable-pacerelationshipjfreechartftpfailoverclusterlibcdestructordeclarationerpsqlite3nginxriad3.jsuiimageviewdesign-by-contractvbscriptcronanemic-domain-modelfinancialrailoprerequisitespartitioningxcode4.2interpolationnsstringbootstrappingjesspolymorphic-associationsprotegeenterprise-libraryprivate-methodstail-recursionetiquettewhitespacequicksortlme4powerpointsizeofdefensive-programmingsyntax-highlightinglistviewbasentfsbridgerule-engineio-completion-portslxmljythontransactionscopegui-designstandard-libraryblazedsproceduremayamacrubycomplex-numbersdhtmltextmatenp-hardalt.netstar-schemasystem.reflectioncohesionfortify-sourcepimpl-idiomxcode5java-8twitter-bootstrapcurrencymsmqtextboxntosx-mountain-lionsmlnjinventoryelispwebservernsmutablearraydynamic-memory-allocationradsimilaritybiosdialognokogiriandroid-fragmentsstoragecurve-fittingtips-and-tricksg++cubedotnetnukelalrgpu-programmingxcode4.4multi-tierinstantiationinfinite-looppackagesbookmarkslotus-dominoemulatortemplate-method-patternkohanagroup-bycookiesms-officevarflashdevelopmicro-optimizationtoolkitlinear-regressionfxcopraspberry-pi2uiviewcontrollerdctsystem.drawinglow-level-codecopy-constructorsoapuirecurrence-relationdrag-and-dropservicebussemantic-analysispalm-osgototemporalpyqturiairwindows-8.1bitwise-operatorsaffiliatemicrosoft-test-managerrelational-algebraprinciplesqtranslatepuppetsoundexterraingridworldcomboboxc89quaternionsvolatilegoogle-apps-scriptlinq-to-objectscomputation-expressiontype-inferenceonion-architecturetortoisesvnmachine-codespark-view-enginedelphi-2007spring-securityconcurrent-programmingprismwaterfallcombinationschatqmlapache-sparkidlcode-reusesystem.reactiveinnovationsigintassembliesbackendgnomejax-rsgraph-databasesoverload-resolutionsecure-codingwindows-runtimerupcodeblocksibeaconcarbontaskmanagermainpath-findingcrystal-reportsbusiness-objectscontactsxcode4.5ecmascript-5productedaunit-of-workdomain-objecteconomicsolap-cubesimulatoreaidata-storagedata-annotationslookup-tablescinboundarymodal-dialogrecursive-querynokiawhere-clauseclouderavectorizationdjango-modelsrabbitmqnumpystdinocpjppart-of-speechaccess-modifierstitanium-mobileuser-defined-functionsrecvrichtextboxjvm-hotspotscheduled-taskscrmfactorialamazon-appstoremaster-pagesautocompletevsxsetup-projectacepandasblackberry-eclipse-pluginspam-preventionbpelspeechurl-routingmingwlspimplicit-conversiongraphical-programmingbuildersdljaxbfile-get-contentssymbolic-mathprocessingdweblogicmatplotlibshapewindows-phone-8java.util.concurrentmongoidgoogle-cloud-datastoresimple-injectorintersectionaspectjvidimensional-modelingbayesian-networksmouseeventcovarianceconsole-applicationttymultiplatformpascallibusb-1.0time-estimationbotnetcomputationclustered-indexhorizontal-scalingenvironmentjbehavewindows-server-2003msbuild-taskwordpress-themingjenkinsmsdnnaturallyspeakingpdoandroid-intent.htaccessclickoncerecursive-descenttrigonometrycom+returnmalware-detectiondecouplingmandelbrotmongoosemachine-languagellvmdelphi-xemultiplicationtraversalscoringblueprint-cssbreeze-sharpp-npmath.hmasstransittegraspring-batchlaravel-4liftcamera-calibrationmicrosoft-commerce-serverconceptualalicedecompilingddddnested-classoperator-precedenceruby-1.9ssclifinalcolor-schemerenamewrapperjulia-langnew-projectdefaultinnodblongjmpgoogle-closurecython32feetabaddressbookpdeautofacspecszosprimespylonsmochaherokuiscsiyagnismartyazure-storage-queuesshallow-copystdioaddtemporarysystem.outflash-cs5kanbanscriptletbroad-phasecustom-componentsbclscala-2.10gesture-recognitionscreenshotjoomla-extensionsputtracecubic-splinewebservices-clientrailstutorial.orgeffectsautowiredwcf-configurationacceptance-testingsamsung-mobilemodularinverse-kinematicsmodule-patternselenium-rccollective-intelligencetreeviewtemplate-matchingdtdnetduinobounded-contextsirvine32gtkcustom-actionjdeveloperclr-hostingwhite-hatdirectx-9dialectweb-partsdatagramentity-relationshipxbox360nintendorecordercomputabilitygoogle-visualizationzend-framework2directcomputephp-extensiondynamic-websitesgoogle-closure-compilermergesortacsjailbreakcontroltry-with-resourcestouchscikit-learngfortranpos-taggersubquerymsbuild-4.0language-switchingcommand-line-tooljmockjfifmember-functionsreference-countingdesign-decisionslistfieldios-simulatorcore-data-migrationwindows-authenticationupdatepanelquotingurl-rewritingpowerpoint-vbasts-securitytokenserviceevent-sourcinginstructionsrequirements-managementvisioaccountinggherkinimplicitsurvival-analysissql-order-byraphaeldata-compressionat-commandskip-listsrecordingaudiounitscrummasterarduino-unoobject-recognitionmonadsdroolsthrowawaycoordinatewildcardrandom-sampleinstallshufflehttprequestprogramming-pearlsformal-methodssdatastoreaudioqueuecustom-server-controlsasn.1http-status-codesnfawgetmalwarexbeeprocedural-generationjsonpextension-methodsleft-joinzookeeperbbcodedji-sdkonclickuser-generated-contentwritingcartrestful-urlinteraction-designrelevancesignaturefactdatabase-normalizationinternet-explorersencha-touch-2jslintqmakeapache-felixlanguage-implementationtexturesdata-partitioningavrontologypsr-2avl-treeobject-detectionmultiprocessorreadonlyweb.xmlehcacherx-scaladesignerconcatenationconvention-over-configurtetrisrtfmediafragment-shaderfixed-pointreferential-integrityworldwind32bit-64bitxsl-forootkitlogarithmpartial-classesdynamics-crm-2011quartz-2dsql-server-cestatic-librariescross-browserspring-integrationsmsmodel-bindingpoeaaapache-pigassignspring-data-jpabouncycastleenvironment-variablesavrcpmixed-modeperl-moduleargcapache2sanitizationpowerbuilderspecflowstarter-kitsdivide-and-conquerpython-requestsstruts2nullablejlabelphpspecresamplingtypescriptgasfrequencymacbookproliferayflat-fileadosocket.iojavascript-frameworkcommon-table-expressionsplpure-virtualwebpage-renderingradioxml-serializationprotectionhandlermono.cecilpalm-prepv3ddelaystatelesshateoastest-firstwindows-azure-storagejarvoid-pointerscustom-exceptionsmachcakephp-1.3design-guidelineswindows-xp-embeddedtransformerdigitformulaarrange-act-assertconditional-compilationphp-internalshqlsession-stateocslabelbittorrentlazy-loadingmulti-touchamazon-dynamodbtext-justifypurely-functionalandroid-servicebignumpollingsubscriptionextendscriptjscriptrpcaxiomamigadelphi-2009metasploitphonemazecloud-hostingcredit-cardopenearsquoteswatir-webdriverpreferencesmagentogoogle-closure-librarybackpropagationjni4netusb-drivevisitor-patternshardingevaldetectnurbsjavacvargument-passingshadrillthroughxna-4.0django-viewsc11spring-datadomdocumentobject-databasescsivtabletimingexpert-systemsystem-administrationedge-detectioncharcluster-computingtestabilityfunctional-dependenciesindesigndeviseinterface-designboost-mplmatrix-multiplicationclaims-based-identityaggregate-functionsrebuildsensorweightedevent-driven-designdeep-copyminifyy-combinatorregex-lookaroundsmulebidsstatic-constructorstreamingweb-frameworksvirtual-inheritancelarge-data-volumesbarcodeip-camerajtablecocos2d-xanonymous-functionglslesappendselfmeasuresmicroprocessorsperipheralshandlestmfinite-element-analysisapp-configpushhyperthreadingci-servercontinuationslong-integermarker-interfacesmultiprocessinginstrumentspapervision3dwxpythonclonejclweb-confightml-formcode-structureunits-of-measurementclass-table-inheritanceprimefacescoutoutput-bufferingminecraftxeon-phicrtpibatispivot-tableruby-on-rails-2symfony1leaky-abstractioncode-patchingapplication-designplayframework-2.0boilerplatedunituiscrollviewcursesdigital-signaturetfs2008githubswapgetjsoncontext-switchfluxmeteortemp-tablesmixed-modelsrepresentationsquarepyjamaselggparadigmsjdk1.5autosuggestpyopenclmaster-theorembreezesetup-deploymentasp.net-web-api-routingtransposejsp-tagsinoderttidjango-1.7traveling-salesmanunique-ptrknitrsplitsettimeoutplonesshobjectcontexttestngrexxcscrx-javantdllepollxamarinstrong-typingxamppdb2bankitunesreusabilityglossarycdcjrubydisassemblyllnugetbroadcastdecompositiongoogle-analyticsunsignednexttemplate-templatesmemoizationtimelineerror-reportingtexozcircular-dependencyvotiveparallel-extensionszipargument-dependent-lookuppower-managementnmakenoexceptteamcitywssassociativityforumsphinxgridviewendiannessadka2dphtml-agility-packcyphersingly-linked-listnumericin-app-purchasetable-drivendequestatic-memberscongestion-controlshared-objectsjavadocdraggableuartcollaborationsql-updateexc-bad-accessvoipsquare-rootsocialencogbasexvirtualembedded-resourcemessageboxlapplycircuitjstlcassandra-2.0pcrevisual-c++-2008-expresscstringactivemqstatakalman-filterwsgiintentional-programmingbllportabilityeffective-javamyisampinvokesurveyclockpie-chartios6externalsimpyreductioncocoa-design-patternsstring-algorithmibm-midrangeios7code-search-enginepdb-filesmanagerempty-listvaxrss-readertypo3monitorminixprototypingesb-toolkit-2.0gae-datastorewordpress-pluginnetbeans-7mesosmulticastwshrvalue-referencesummarydisjoint-setsthread-synchronizationintellij-ideaphotographytimezonelanguage-comparisonsip-addressiokitecmascript-6fuzzingcompiler-designgradientrevisionthread-local-storageweb-traffickendo-uiapplication-serverxcode7parent-childabstract-factoryxmlhttprequestdata-integrationturing-completeredirecttrackingoperator-keywordpolicyproduction-environmentpcdatabase-projecttypingabstractcontrol-flowaslrgyroscopecbc-macmicrophonecpu-usagerandom-accesslensesdecoderemote-controlhudsonconnection-poolingmaintaining-codeflowchartscadalync-2010spring.netreference-classfull-text-indexingjnienvstack-tracejoomla2.5error-recoveryportletaudioqueueservicesternary-operatorterracottagcc-warningmeshdisambiguationgcc6soa-suitesymbol-serverpdf-generationssas-2008midlproxy-patternhuffman-codingdiagramslaw-of-demeterquantum-computingownershiptabsdimensionms-access-2007adjacency-listapache-camelwsdlgacdocument-classificationpowermockitorigid-bodiesdatacontractsettingsmvccclosconfiguration-filesauditstdmapimage-segmentationmeasurementautoboxingpicbackwards-compatibilitybase-classsignedasp.net-web-api2network-scangoogle-spreadsheetmspeccase-sensitivetechnical-debtautofixtureaxis2helperangular-momentumtext-parsingmembership-providerselectorclrsservice-brokermwstitaniumremoteiomergewpf-controlsdalvikmethod-overloadingdjango-appscorsrpgledivisionmibcode-translationconcrete-syntax-treemultilingualobject-lifetimemonoidspayloadmathematical-notationdartphpdocvoice-recognitiongawkms-media-foundationlanguage68000glibcjathastochastic-process8086findthemespoint-of-saleendpointstessellationresponse.writemultitaskingguavadocbookmsbuild-propertygroupef-model-firstflex-mobilecomputational-financeseamcombinatoricsvectormathmoneymodelscode-cleanupjava-ioaddressingdjango-querysetxorgissequencenp-completediskurllib2mutual-exclusionlibgdxmedianvisual-studio-addinssamplingsleepminimaxdatabase-theorybuilder-patternoperationcomputer-science-theoryburndownchartsopenbdzigbeezopeembeddinginstallerkshgravityelasticsearchuserandroid-canvaspaintssmswcf-bindingextendpowershell-v2.0dicomgeolocationproduct-managementconfigurehdfsvideo-processingpremature-optimizationautoloaderscheduledexecutorservicelocal-variablesiqueryablecss-floatwix3.6gnuplotgraphicgoogle-chrome-osextractcommand-line-argumentsscreen-capturecodeccopy-protectiondurationlexical-closuresjava-ee-7preg-matchfedoraiifeblueprintlegacy-databaserdfapowerpcc64thread-priorityjgraphtwampprefixinteractionfortran77failoverexecutorgpioconceptinlineobject-modelrhinohtml-tablebeagleboarddata-transfer-objectsleadmultiple-dispatchfacebook-graph-apicrudwatirdmamappingradio-buttoncode-designinterface-builderloose-couplinggreedyshadowpyobjcsmpdatabase-migrationcomputer-forensicsvoronoilibjpegserial-communication32-bitmyfacesheap-memorywcf-clientsublimetexttlbjava-streamexponentiationservicemixmahoutdecoratornullpointerexceptionphp-5.3imagemagickoutlierspivotamazon-marketplacegit-mergeadd-inevent-simulationpaxoshigh-loaddrivesflash-builderstereo-3dmanaged-c++zend-viewpearcode-readabilityeraseflyweight-patternsuffix-treebeanshellofflinejavascript-objectsagentboxingmodern-languagestest-data3d-modelexportpublicassetsmojobackground-subtractiontrafficzenossshellsorttabletuitextfieldbranch-predictionfaceted-searchopencartreportviewerstandards-complianceisabellecustom-eventsbipartitedense-rankwizardsecure-sclevent-listenerslinkifyoauth-2.0unsupervised-learninginternet-explorer-10distractionsx++smackderivativeautomappingtruncater5rsstdthreaddocumentviewerdocument-managementbluezrust-dieselmacbooknhibernate.searchlockscgpdfdocumentproducer-consumermysql-workbenchcompiler-optionsexploratorydereferencefloating-accuracychromecastmicrocodinglabelsmsys2mouseovertwo-connection-limitweb-deployment-projectend-of-lifejsscproceduralwith-statementtabbaruser-managementsentiment-analysisjquery-selectorsmembusdotnetnuke-modulepsychoacousticsaero-glasshigh-trafficbackupfact-tablexamarin.androiduninstallbcintelrectleaderstringbuilderfakeiteasyjavacardplayframework-2.5vdspobject-initializersdynamics-ax-2009rcppdbix-classsunrpcneurosciencegtdmips32rating-systemsubroutineknockout.jsxenbuttonclickinfrastructureadomd.nethypervisoractionlistenermsdeployjasminequestion2answerdbicategoryjcespacenonlinear-functions.net-attributesnanivarcolor-managementsoap-clientroinotification-bardatatablecfcmultiple-monitorsjoysticklistingsjsf-2.2recordsetvb5class-instance-variablesuser-inputbabylonjsmfccscrumboardretrospectivesclass-methodenergyfacadestdoutelementadminfont-lock-modeglsurfaceviewcalculusinteger-overflowvoidexpansionuicollectionviewlayoutportraitdenotational-semanticsqdatetimeicommandmandrilllnflowdocumentgoogle-booksquerydslmac-classictuimanagedobjectcontextsapigeneric-functiondataformrspec-railsvalueupnpvs-unit-testing-frameworkspiswigaggregaterootcommit-messagepylintdigitaliphone-privateapiflash-cs5.5angularjs-factorycyrilliclibtoolsnmpdsequence-diagramviola-jonesexecutiveshole-punchingentity-framework-corestocksimplicit-typingrosmodbusgzipipv6crypto++aliascss-selectorsddd-servicevisualsvn-serverirqgoogle-pluspage-load-timectypeswininetevent-based-programmingservice-discoveryblendinggarnet-osinfraredcontinuousxml-parsingnsarraycontrollerinventionsotpdmpmexdsaoxygenegamepadcss-frameworksbezier-curvecappuccinomemory-segmentationinit-parametersfpsgnuradioeclipse-pdtopendireulaphasebuild-errortableviewbatch-processingcode-documentationdetectionunobtrusive-javascriptandroid-layout-weightcasablancacase-classhttp-status-code-403cloud9-ideceleryconfiguration-managementinternet-explorer-6google-searchanonymousunmanaged-memoryscala-collectionsdoxygennioandroid-bleparasoftautomated-deploybacklogname-lengthcp866betamasm32clssosexexpression-treesbinary-operatorsuser-agentprinter-control-languagedistributionillegalmonitorstateexcephaxeusage-statisticssbthttpclientaddressing-modeopcparallaxrendermemory-modelosgi-bundlesql-subselectpacmancoding-efficiencyheightmotorolaair-androidregister-allocationprofilesproj4jquery-ui-pluginsminimalmodbusbusiness-rulesaudio-convertercplexdjango-templatestimtowtdiscreen-orientationlegosolr-celldmdquantifiersfipstext-to-speechseasidemp4gnuradio-companionhelpermethodsrubocoptype-librarymodelbindersoverheatingderived-classglfwsmtppitch-trackingrmarkdowntree-balancingtexture2ddevtoolsopenjdkmagic-numbersndefruby-2.2polygononmouseoverendorsedmicrosoft-metrocurly-bracesgoogle-mapsdotnet-httpclientfetchasp.net-coreteradatalcseclipse-gmflimitsocial-graphbitconverterucabsplinespring-webflowdrupal-themingsieve-of-eratosthenesz3er-diagramsjboss6.xcomparatornapebacktrackingxml-rpcwidgetsunstudiolocaldbundoruntime-errorbufferinganchorgit-commitnsimageamortized-analysisjavasoundrichtexticuadldsdynamic-loadingdefault-valuecoldfusion-9tmparameter-passingnsblockoperationadaboosttest-planenterprise-architecttstringlisthpcdevice-contexturl-validationaffinetransformnet-snmpgladestringstreampassword-hashmemory-fencesrunspaceshfbms-dosobjdumpribbonbigtablebrownfieldcontourcallbynameprepared-statementjtextfieldassembly-signingadministrationgen-eventlogical-operatorstagfilelong-doubleequivalentinterface-implementationcentercursorgoogle-earthuipopovercontrollernstimeramqpmixture-modelkeyloggerbackground-imagetesting-strategiesvirtual-machinexamarin-studioinfopath2010calayercode-first-migrationsvolatilityjavafx-8wmlreturn-value-optimizationdotnetopenauthandroid-sqlitedropwizardtrunkcore-locationreflection.emitsqlclrsql-server-2014-expressasset-pipelineflatperspectivevisual-c++-2005contractsecurity-rolessanitizeunion-findstatechartstakerberoscollaborative-filteringcrosstabbubble-sortssjscustom-error-handlingintranetsolutionakka-clusterbazelnsaffinetransformbitcountbulk-loadbusyboxtradingsingularmarshallingkeep-alivexnanimationdouble-dispatchurlopenget-requestprincipal-componentshypothesis-testnotnulldirectshowkinect-interactionstdvectorxpslisp-2atomedit-distanceprogressivedeployment-descriptorodeintansi-92nsmenuitemserializablearray-initializationmustachedatabase-integrityruntime-compilationjquery-uiundefinednon-staticgattparametric-equationslsaroundhousestripestask-trackingalarmmanagerdefaulted-functionsalgebraic-data-typesmorfikhsmraw-socketsnetfiltericefacesassimpgreasemonkeyevented-iogenuinechannelsr-gridmultiple-tablesgoogletestdataflowsize-typemultimethodcapitalizationjmockitrubymotionxor-linkedlistcompass-geolocationssairepositoryqtquick2set-covermem.-efficient-linkedlistjtagoutputradrailssiebelmanagedsdpwavefrontdlnaubuntu-14.04mapperrootgroovyshellsequencescompass-sassienumeratorfunction-overloadingyoutube-data-apiobject-role-modelingwss-3.0s#arp-architectureaforgevariadic-functionslilypondnumber-theorysonarqubeactivitiactivity-monitorasp.net-mvc-areaslyncrelational-modelfactor-langlogic-programmingpickleprims-algorithmc++-ampjspincludepaddingmemory-corruptionopenpgphfilelisdocstringxcode5.1cjksliderplaybacksize-tconceptual-modelfeedsmtajoomla3.0ext3elastic-beanstalkcodigettextmove-semanticsmobile-applicationantlr4topologyuploadnull-object-patternactiveresourcekettleshopifyflood-fillface-detectionscreen-sizearbitrary-precisionfat32remote-accessintegralamazon-fire-tvbackground-processmefshoppinglibvlcaxsfinaeparallel.foreachstate-managementhttpwebrequestdependent-namejasper-reportsandroid-runonuithreadansi-sql-92j9chaosliterate-programmingcopy-assignmentwaitpidplacementvxworksheadaveragetensorflowhardware-accelerationuiview-hierarchycapistrano8051game-loophdcpogg-theorafeature-drivenwmfcodepagesarrowsha256script#kernel-modeproject-organizationcouchdbimage-zoomfinallypalm-pre2qt5backlightedidefaultmodelbinderacr122flushoutlook-vbaapache-portable-runtimephantomjsvirtual-pathcardinalityvisiondelphi-7pbxlibavirbx509certificatecshdockpanelyuvembedded-databasemotion-detectionss7openid-providernodesfitch-proofsopen-closed-principleui-helperoracle-ucmchange-data-captureskinningrmscairngormbinary-heapplyrfreeglutlines-of-codegoogle-style-guideoverridinghttpartyfseekpostswavdynamic-reportstranslatetomcat8roxygen2forgot-passwordschedulermixerieee-754netbsdexchange-servermsbuild-targetinstancesanonymous-inner-classvideo-editingoracle8iweldlandscapeswi-prologandroid-loadermanagerin-memory-databasefoafglibthreadgroupworkflow-enginelibc++linodemercurialdouble-checked-lockingautotoolscxfmaven-javadoc-plugincustom-eventsubjecticonshaskell-platformhardware-programmingexecutorservicetype-conversiontwiliowindows-identityentitiescache-controlsaxonout-of-memoryprintersdeclarativeintrusion-detectionwcf-restsilverstripecsrfdataframemultiple-indirectionrationalestreambufdatabase-firsttao-frameworkportfoliocqlcross-domaininstallshieldreallocpre-incrementlokiubercartbessel-functionsfile-conversioncomparablestarling-frameworkcyclicbarriernscoderdigital-logicturboc++agent-based-modelingoledbphotoshop-cs4lib-nfciphone-sdk-3.2svdnswindownegationfile-descriptormediacontrollermingw64cpythondatabase-tablehlslsassblockingqueueinterlockedchange-passworddecision-treepresentation-layerphpstormwapifftjson-apirefsaltcontainsstartupcadrecursive-datastructuresphylogenyupperboundgit-gcdata-entry.net-remotingjavafx-2sound-synthesisdesign-rationalegoogle-codegoogle-play-servicesgmailhoistingstm32texnic-centerosbmatlab-cvstoracle-coherencethread-localdata-profilingexecutable-jarsimultaneousrecurring-billingnumbafortran-iso-c-bindingsgigprsas-ifproject-layoutmechanizelocal-storageuigesturerecognizerguicewebdeployfeature-detectionminesweepersyntactic-sugarmanifestproviderwebservicehost3d-reconstructionmachine-translationsoftware-estimationtilesdatabase-managementjfacetaxonomyonline-repositoryhttpcontexttable-variableconverterinvalidatelua-tablec++buildercross-compilingtype-constraintszend-studiopopularityzshautolayoutdllimporthamlwebmatrixapplepayvisual-c++-2008triangulationnuget-packagecpanelfont-sizerefreshgraph-coloringgoogle-calendararm64sourcegear-vaultgetlatestyield-returncredit-card-track-dataexchangewebserviceslrusapfrontpagegroebner-basistreemapthread-specific-storagegoalironkey-value-codingvisualvmvisual-foxprojoomla1.6ibplugingtk3fast-espbox2d-iphonemotionnsoperationlcdspec#first-class-functionsfuzz-testingflexunit4virtualhostwpfdatagridswingbuildergit-tagcpfreebaseuiimageunmanagedanonymous-methodssitecoreoutlook-addinregression-testingwardenazure-documentdbfinal-classhard-codingapache-tikadvorakcppunitintegritysharepoint-2013companion-objectmac-app-storelotussupervised-learningconcrete-inheritancegetchmmapyahoo-financevmwaresliceapache2-modulemod-sslgridrisk-analysiszend-aclhammingweightwebsphere-mqlong-pollingcucumber-jvmhapijsreference-typeinjectsimplemembershiphectorprivilegesssrs-tablixrvaluenormal-distributionjxtavector-graphicscompound-operatorumbraco-blogclasscastexceptionasp.net-mvc-5invariantsmemory-poolstatsmodelsgenerativeasyncsocketregex-greedymsbuildcommunitytasksidentifiercrackinghash-collisiondelphi-prismdataproviderterminationmultiple-columnsrestifymonomacburnobservablecollectionscikit-imagecherry-picksniffingmethod-namesandenginev8compass-luceneimage-scannercdbdigestmutableweblogic11gsysvshorthandnstreecontrollerkarma-runnerrdbms-agnosticparameter-sniffinggnupgmysql-managementfindbugsmptttexture-mappingnhibernate-mappingmysqldumpu-bootcustom-buildmailslotacronymreorganizemahjongjboss7.xabstract-methodscounterbeautifiermessage-loopqgraphicssceneyoutube-apicoordinate-systemshttphandlertemplate-enginejdoautomatondelphi-5silverlight-5.0nice-languageportsgnome-3morphiafreertosredoquadtreegalaxyqgraphicsviewknuthhp-uxmayavigreatest-n-per-groupinclude-guardsactionresultencryption-asymmetricglewaccess-tokenstagingconcreteonpaintbrowser-cachetcshappframeworkniosfscanfoverlapped-ioeclipse-emftrampolinespersistence.xmlheader-onlyusb-mass-storageuitabbarcontrollernpscsftpl-dataflowpysideolexml-attributecopy-on-writeminimum-spanning-tree2-3-4-treeunpivotcodeplexswift2splinesql-deleteminimizelifecyclesrsfasmgriffonyqlvirtualboxoctreepredictprogram-flowshippingfilestreamimage-rotationgoogle-gdkchemistryipodssrs-2008appletpython-imaging-librarysafaridiscrete-spacecoldfusion-8recordsdrop-down-menuconcattemplate-haskellcalculated-columnsbeginreadxml-validationgrantclpqsymbolcircuit-diagramlightweight-processesidiomatic-perlimpersonationobject-initializationfeature-extractionmaven-3nested-loopsvisual-studio-expressclionexplorercheckboxcross-validationtyruscommentingusing-directivestouchscreentypesafe-activatorumbracox509certificate216-bitpygtkcomposite-keyexpression-evaluationcode-behinditerableadfslarge-filesaudio-recordingtr1qgraphicstextitemuieventelliptic-curveownerdistributed-cachingnsmanagedobjectrich-domain-modelcontravariancebigdecimalbare-metalcircuit-breakersysinternalsmockupssquishgrails-2.0parsekitfwriteaccessorybrute-forcemit-scratchnetbeans-platformaudit-trailpacket-snifferslate-bindinglistenermongodb-phpmsbixllpegormdatabase-tuningruby-on-rails-3.1spring-restcontrollerkerningwaveletbinary-compatibilityalertsgnatcgpdfscannerscalar-subqueryddlcellular-networkcan-busbit.lyfile-extensionevent-loopclass-hierarchymoosepreg-match-allflagsantivirusnoncopyablemedia-playeralloyrefcountingportalmatchingconst-correctnessandroid-studioinner-joinui-threadscheduleinterceptkiffluprgbecmamfiwhite-box-testingmodemdagger-2metapostdmlgpuimagecircular-referencestack-smashtransitivityremindersopenid-connectround-robinwtsap-connectorduplexocmocksystem-verilogentropystatusbaraccess-controltablelayoutalexa-skilldelegationgalaxy-tabtostringwxwidgetspos-taggingidempotentstabilitydata-cleansingasset-managementfile-permissionsrefactoring-databasesappkitcontext-specificationintellitracerpnscaleebnfdomxpathcommitmost-vexing-parseionictodosui-testingbindingsourcehexrolapfluorinefxbreakpointsoffice-2013color-spaceposix-apiradix-sortjlistargventry-pointweb-application-projecttext-filesdifferencepayment-processingskyfieldservice-layerlaunchobject-object-mappinghuman-readablejdbctemplatetypetraitsspray-jsonmozartfisheyecashomebrewcommerceuniquexslt-2.0windows-kerneloracleformspointer-conversionputcharjquery-globalizationedirectoryfiberrustpost-incrementkissfftbin-packingdelphi-xe2cortex-auinavigationcontrollernon-exhaustive-patternsdistortionequalizerline-intersectionslugspinlockslowdownscreen-brightnessvspackageerasureweb-config-transformmaybecode-migrationnsbitmapimagerepautomatic-ref-countingclass-variablespppuniqcygwinkinect.toolboxvirtuemartsimplyvbunitre-engineeringsudokulocaltimepharoiis-expressbeagleboneblackisbnteam-buildscrollinihidden-fileshungarian-notationstripe-paymentsimpactjsgnu-toolchainusability-testingoculusnsbuttoncellwebspherepowerpivotlibsvmevent-logpath-manipulationfirebugreferential-transparencytestdrivendesignpowersetdelimiterfunction-objectfirewalldelete-filejsdocvirtualallocdrmcycleidataerrorinfoblendthriftchecksumhadoop-partitioningrootviewcontrollershift-reduce-conflicthoverdomain-service-classintellij-13callocopenjpaoffice-2007scope-identityy86unionvrlibusbapi-keymicrosoft-fakesunreal-development-kitcard.iomemory-efficientosloxnuautomapperef-database-firstimage-enhancementdfsvpsmpegbitarrayxcode4.3avx512distinctcommodoredividestorage-class-specifiertrussstreet-addressprogram-structureselinuxjqtouchspatial-queryjustmocksingle-table-inheritanceparentopamnsbuttonjquery-ui-timepickerireportgwt2session-hijackingdefaultlistmodelrowremote-serverapplication-integrationinstance-variablesandroid-widgetvisual-studio-sdkdouble-clickkendo-mobilecompiledderivedalexa-skills-kitstructured-programminghttp-errormootoolsl-systemsbasicanalysis-patternsbapiios9.3gnu-smalltalksse2spring-data-neo4j3dsodatalmdirectx-10drawrectcomparison-operatorsjxcode7.3aixamazon-storedata-generationgoutteleiningenmisusent-native-apiqtcpsocketia64autoiphone-accessorysmartcardstorewhereinsertion-sortssdtboost-date-timemagnetic-cardswebrtcandroid-frameworktfs2013business-layerintermediate-languagespring-aopc#-6.0nomenclatureentity-modellgplsharedplyrgoogle-tvtimertaskclass-attributesphotogrammetrydcidata-drivenstanford-nlph.264ocpfilechoosersurfaceerror-correctionbitspymccapturexperfviterbivelocitygprofdatamartsemicolonpublishingboost-graphmouselistenertelerikshort-circuitingfeedbackios-ui-automationbinderlatencyopenjmsnumerical-recipesraspberry-pi3eclipse-emf-ecorejfilechooserquantifydarwinrdlcdecompressionmmunested-urlseigenup-castingwebosrequest-cancellingaccelerated-c++vc6lldbhill-climbingdifferentiationpostfix-notationngroute.bash-profileappstore-approvalwebdavcode-conventionsgraphics2dgraspuitypeeditorcompatibilityconstexprdeterministicconsistencycryengineemvandroid-2.2-froyoappdatajs-test-driverresultsetektroniframeforward-declarationpostscriptsoundcardpathgeometrypowershell-remotingpy2exehtml-selectlook-and-feellanguage-conceptsxsd-validationtransducernsstreampanlower-boundiec10967scapyclojure-core.logicmelregex-negationhibernate-mappingpartial-viewsselectlistgoogle-api-clientfile-organizationscrapersingle-page-applicationaccess-vbacrc-cardsjavacctweetsfoundationinteractivelogitechstatefulrowslinearizationstringbufferistringstreamthinitextostreamqueuingledpyserialreactive-programmingretainbitflagslpcpointer-arithmeticzombie-processconcurrenthashmapcreationzend-authdynamic-language-runtimeedit-and-continuecalculated-fieldevent-dispatch-threadqprocesstopic-mapsdaggeridentity-operatorsealedeachsim900haskell-modeelementsaspects3-tierandroid-syncadapterovertonehtml5-canvaspowershell-v3.0lookupdependency-managementpublic-keygunicornopennlpmozillarabbitmqctlmechanize-rubypgpjsonpathvisual-c++-2010erase-remove-idiomsonosexplicit-conversioneloquentopendatawebbrowser-controlscientific-softwareruby-1.8suitenescgaussianquery-performancedrawstringsession-timeoutapplication-structuregetcharjlsmosstomcat6bold-delphijscript.netisp-principleobjective-c++blockpysparklinecobol85usbserialsummarizationwebdriversqlalchemynumberpadslidemodularizationpreloadinginstruction-setopenalz80custom-attributesservice-referencemsp430ninject.web.mvcpenetration-testingshell-extensionsimage-capturesynchronizealignmentmatchretina-displaycore-textexecution-timezeromqwindow-functionssecond-level-cachestatic-filesjboss-portalexternal-accessorysystem-analysiscustom-membershipproviderwidthgnu-makeopenslbackbone-routingn-layerglobalsdynamic-assembliesnetbeans-6.9uibezierpathservlet-filterstandemqvtjavafx-12phase-commitimageiconnsubstitutedata-tracingsemantic-markupmatlab-coderrails-activerecordgraphical-logoplaying-cardsdrupal-themesisolationmolesadventureworkspypylinq-to-datasetblowfishrowlockingunity5wchar-tpositioningiis-8restkitasp.net-mvc-beta1naglegoogle-oauththread-sleepweb-deploymentvalgrindios9clauseios-universal-linkswcag2.0pyephemview-model-patternlinearsystem.arraypuppet-enterprisesupervisordodp.netwcagandroid-bluetoothgraphingqtablewidgetsessionidcgaffinetransformundo-redoasp.net-core-mvcexport-to-excelrspec2iptype-aheadvgathrowabletraining-datatreapsparqlyesodvisual-studio-debugginghttp-status-code-404in-placeservicehostdjango-celerybox2dnonlinear-optimizationnprreversionjetweblogic12cinformation-visualizationmoaiwindboolongdata-collectiontomeelamppython-db-apihindley-milnergruntjsgoogle-analytics-apipodnative-codebounding-volumepolicy-based-designskinavaudioplayersubmitperformance-estimationhttppostedfilebasenmapopentksparse-matrixencodespring-elandroid-sourceproxyplovrpyqt4facebook-chatreasoningbackbone-viewslogistic-regressionselflanguagecoverflowrational-unified-processhttp-requestmouseenterword-frequencygit-cherry-pickcapprolog-topleveldoctrinefolderscbperipheraldiagnosticside-customizationfixedpagepywin32java1.4url-shorteneruiimagepickercontrollerhotswaptimespanhpricotsharepoint-apionclicklistenerunresolved-externaloculus-runtimestrictxorgmidjeemail-spaminvokelaterpentahoudevalphablendingupgradewebshopado.net-entity-data-modelsqlyogdynamic-castimmutable.jsresource-contractsproject-templatezippersystem.diagnosticsboidsvisual-studio-templatessniffercontrol-charactersegovernmentxml-signatureloadlibrarystochastictrieeasymockvariable-lengthapriorifogbugzquotationsfusetwos-complementshelvingsinglepageweb-site-projectcorbanlmelight-injectfaultwsclossless-compressiongamingxdt-transformformatsalesforceidispatchwcf-ria-servicesmemory-mapped-filesthreadxintel-edisonaccountmanagerc++03activex-documentsdefault-constructortargetbreadth-first-searchswcexittelephonytbbspritelowpass-filtersconsxaequality-operatornon-typememory-editingwinrt-xamllrculturetransactionaljob-schedulingfilesystemobjecthtml5-kickstartwireframesamlcontrol-structurequery-tuningapplication-layerw3cparticleintel-micpngraycastingcombinatorsemtransaction-loghtml-content-extractionperiodprivate-keysigilskolmogorov-smirnovcontext-boundx11documentation-generationdeclarative-programmingncursesunordered-mapbarcode-printingvalidationattributemod-perljavassistcaliburn.micromscapihttp-headerspyopenglazure-storage-blobswindows-embeddedcommercial-applicationcharacteristicsactionsimulinkgranularitycryptoapiprotocol-buffersocunitgreen-threadswindows-integrated-authpidscalatestprogressdialogscenariosdbunitpowershell-v4.0stubsedifacttypographycore-imagentpindexofasterisktfs2012resource-managementdata-consistencywinddknpmcoldboxhtml-listsilasmuicollectionviewnopcarouselcs50rdocsrandcross-correlationwindows-explorerfrebinstagram-apipostordervisualdesignerlexical-castmenuitemdynamic-arraysjava-ee-5dynamics-crm-4tildefile-sharingdjango-urlsoverusestored-functionsoptionscreateobjectbibtexrubymineironpythonqtableviewreducingnsdatamod-rewriteisoblobchomsky-normal-formwin32guitightly-coupled-codecomment-conventionsdocument-databaseoverwriteandroid-sensorsdespass-by-rvalue-referencelspictureboxcontractsactivesupport-concernuibuttonmethod-signatureinterpretationasp.net-controlsspell-checkingobject-oriented-perlstring-substitutionpowerbuilder-pfcwindows-95servercontrolspitchzseriestransitionsglkithornetqtype-providerspostsharpiommussdamazon-snsplaneweb-controlsautomatic-propertiesbrokertre-libraryspellingpygleteasyphpqthreadapproximationjcanvasstring-lengthhrefweb-farmmapkitmsysgithp-nonstopcontroltemplateslatitude-longitudesimplifyvoxeltesseractmulti-table-inheritanceproperties-fileioexceptionevent-storeobject-createclearcaseidocscriptmethod-chainingextreme-feedback-deviceshamcrestmongodb-queryida-prosurfaceviewdjango-ormprivate-constructorpromptvmallocumtsalunstimeintervaladtinter-process-communicatwifstreamhsqldbpcmdocumentdatabase-restoreviewresultspecializationdepth-first-searchestimotesuppress-warningswin64god-objectfaceboxavassetreaderhttpresponsemnesiaopenmpipetapocominikanrengeographical-informationvipsgotchasmongodb-csharpbundleexcel-formulamissing-datapageloadstrict-weak-orderingmapping-modelexcel-2007navigation-drawerkextrender-to-textureclojurescriptmodula-2directed-graphangularjs-serviceattsilverlight-3.0dftdemoservice-locatorcorrectnessperl-data-structuresboolean-expressionnuget-serverdecodinggsoapcase-insensitivenxtrfidlightingflowlayoutpaneldjango-admincircular-bufferunrealscriptjgroupsaudio-processinghiveabapvncside-effectsprofilerknnstatic-typingprotected-modefirst-order-logiccode-by-voiceansi-cdirectoryservicesinterpretedlocklessnsimageviewuicomponentsws-federationusernameowinurl-patternwmi-queryqsortcls-compliantaccelerate-frameworkformatted-inputsafety-criticalargument-deductionstring-comparisonservlet-containerexpectalterjxlheap-randomizationuseridextjs4shtmlrow-numberrelative-pathviewmodeloccasionallyconnectedpowermockfacebookeraudio-streamingpage-lifecycledeferredberkeley-dbnamed-entity-extractiondoubly-linked-listvertex-shaderfacetd2rails-routingrtpshortcutexpression-templatesindustrialwhmdaxbpmnstringtokenizerspreadsheetinitial-contextbuild-scriptscalaralexa-voice-servicepipelineray-pickinglinesazure-active-directoryimageviewresponsesetjmppolyhedraunificationmessagesarduino-idelagsqueakintervalssetfocusorchestrationnao-robotandroid-permissionsthrowjbpmtimeoutexceptionyarndeep-linkingone-to-manypipeliningidocrelative-addressingwildflystaruml.net-corepalindromeandroid-uixulrunnerduck-typingamazon-elbpingreverseperspectivecamerasql-server-2008-expresspixelmetatrader4variable-typesfoxproswingworkerxtsjekyllshared-nothingactionscript-2apkeaaccessoryhtml5boilerplatestatic-factorymmslibxml2swizzlingapache-spark-sqlpolynomial-mathphobosucmafgetccbirheightmapjoptionpanesublistflash-messagevlcaccessorsavonriscwebhttpyui3xjcdatabase-administrationfinite-state-machineopc-uamember-pointersmindstormsspring-profilesstructuremapprettyfacesdna-sequencecondition-variablejndiwcf-hostingbracespresentationcatalystjquery-tooltipobjective-c-categorynsisaplcreate-tableseriesnswindowcontrollerdatabase-replicationdecrementmathematical-expressionsviewbagitemgroupjboss-mdbdecltypesequentialfaceletsrepeatsdl-2real-modedo-whileext4sitedesignprolog-difc-librariesiis-6context-sensitive-grammarflowthe-little-schemershiftia-32sybaseseeklog4jqt-designerreactiveuisftpnsregularexpressiondbcontextadjacency-matrixtracingbuild-systemcartesianchannellinux-distrosehc++-conceptsroslynhadoop-streamingrgsdirent.hvsewsspartial-specializationamazon-s3netshpatchboost-asiolow-memoryserialversionuidrs485visual-web-developerinputstreamvisual-studio-2003image-conversiondelphi-6dotnetnuke-imcmit-schemeentitymanagersignalrunique-constraintlocalstokenizeplpythonchunkingboost-anycpu-speedpage-tablesfilteringinformation-hidingshapefileyasmfractionscpancasevirtual-destructorobject-pascalsql-server-2014event-based-componentseclipse-gefverificationdepth-buffertext-extractionrelaycommandorientdbembedded-languagenotifyhypertalkpci-emarklogiccartographyaddsubviewjbuttonsuspendmach-o.net-micro-frameworkcatalogsts-springsourcetoolsuitemasterstellentcss-specificitylevelsconnectionssandcastleurllibldpresenterchicagobossprototype-programmingduplicate-removalcmake-guitype-systemsdocument-readyuuidconnectrecurrencesublimetext2firebirdjquery-effectsappiumoauthis-emptyfind-by-sqlhypermedia3d-modellingusergroupsvnc-serverroguelikesuperclassinsightbusdynamic-scopefunction-templatesandroid-mapviewbytebufferfunction-pointsrights-managemententity-framework-4.3identity-mapspatial-indexfibonacci-heapstatementswhite-boxopencmsdatabase-agnosticnetmodulessparcdecompilerarmcccakephp-2.0azure-web-rolespikecross-productlotus-notesnspredicaterobotandroid-navigationviewps3securityexceptionappdomainblendersql-scriptsdemoscenefancyboxextendspiautomated-deploymentnoscriptdxgitouch-typingjava.util.scannerpython-3.3django-staticfilesgenerative-artpci-dsscancurryingnonetypesql-execution-plantaggingambaatomicitymotion-planningaccurev6510adhoc-queriesmongodb-rubycircular-listsystem-requirementsforumshidden-fieldframehttp-getwavec++98cap-theorembiological-neural-networkautoclassoracle9iclass-visibilityfile-readfluidurwidzend-formhostnamewindows-shellresolutionandroid-dialogreducersitanium